@default<html><body><h2>Algorithm description</h2>
<html><body><h2>Algorithm description</h2>
All files (*.*)QgsProcessingParameterMultipleLayersAll files (*.*)There is not active layer.There is not active layer.Active layer is not a vector layer.Active layer is not a vector layer.Active layer is not editable (and editing could not be turned on).Active layer is not editable (and editing could not be turned on).{0} files (*.{1})QgsProcessingParameterMultipleLayers{0} files (*.{1})All files (*.*)All files (*.*)Selected algorithm and parameter configuration are not compatible with in-place modifications.Selected algorithm and parameter configuration are not compatible with in-place modifications.Could not prepare selected algorithm.Could not prepare selected algorithm.Error adding processed features back into the layer.Error adding processed features back into the layer.{0} files (*.{1})ParameterRaster{0} files (*.{1}){0} files (*.{1})ParameterVector{0} files (*.{1})Default extensionDefault extension<h2>Input parameters</h2>
<h2>Input parameters</h2>
<h2>Outputs</h2>
<h2>Outputs</h2>
<p align="right">Algorithm author: {0}</p><p align="right">Algorithm author: {0}</p><p align="right">Help author: {0}</p><p align="right">Help author: {0}</p><p align="right">Algorithm version: {0}</p><p align="right">Algorithm version: {0}</p>ErrorErrorSeems some outputs are temporary files. To create test you need to redirect all algorithm outputs to filesSeems some outputs are temporary files. To create test you need to redirect all algorithm outputs to filesAPIsDialogPythonConsoleGenerating prepared API file (please wait)...Generating prepared API file (please wait)...AddModelFromFileActionAdd Model to Toolbox…Add Model to Toolbox…ToolsToolsOpen ModelAddModelFromFileActionOpen ModelProcessing models (*.model3 *.MODEL3)AddModelFromFileActionProcessing models (*.model3 *.MODEL3)The selected file does not contain a valid modelAddModelFromFileActionThe selected file does not contain a valid modelAddScriptFromFileActionAdd Script to Toolbox…Add Script to Toolbox…ToolsToolsAdd script(s)Add script(s)Processing scripts (*.py *.PY)Processing scripts (*.py *.PY)Could not copy script '{}'
{}Could not copy script '{}'
{}AddScriptFromTemplateCreate New Script from Template…Create New Script from Template…AddScriptFromTemplateActionToolsToolsAddTableFieldIntegerIntegerFloatFloatStringStringVector tableVector tableField nameField nameField typeField typeField lengthField lengthField precisionField precisionAddedAddedAdd field to attributes tableAdd field to attributes tableAggregateVector geometryVector geometryAggregateAggregateInput layerInput layerGroup by expression (NULL to group all features)Group by expression (NULL to group all features)AggregatesModelInput expressionInput expressionAggregate functionAggregate functionDelimiterDelimiterOutput field nameOutput field nameTypeTypeLengthLengthPrecisionPrecisionAlgorithmClassificationPolygon intersectionPolygon intersectionVectorize raster layerVectorize raster layerInterpolate (Inverse distance weighting)Interpolate (Inverse distance weighting)RGB to PCTRGB to PCTRasterize vector layerRasterize vector layerPolygon identityPolygon identityPolygon dissolve (all polygons)Polygon dissolve (all polygons)Polygon unionPolygon unionInterpolate (Natural neighbor)Interpolate (Natural neighbor)Merge raster layersMerge raster layersRemove small pixel clumps (nearest neighbour)Remove small pixel clumps (nearest neighbour)Interpolate (Nearest Neighbor)Interpolate (Nearest Neighbor)Interpolate (Cubic spline)Interpolate (Cubic spline)Interpolate (Data metrics)Interpolate (Data metrics)Reproject raster layerReproject raster layerExport raster layerExport raster layerPCT to RGBPCT to RGBExport vector layerExport vector layerPolygon dissolve (by attribute)Polygon dissolve (by attribute)Remove small pixel clumps (to no-data)Remove small pixel clumps (to no-data)Interpolate (Modified quadratic shepard)Interpolate (Modified quadratic shepard)Merge vector layersMerge vector layersReclassify (simple)Reclassify (simple)Execute SQL on vector layerExecute SQL on vector layerRaster layer informationRaster layer informationContour linesContour linesCreate graticuleCreate graticuleFire spreading simulationFire spreading simulationPolygon differencePolygon differenceCreate graticule from extentCreate graticule from extentPolygon symmetrical differencePolygon symmetrical differenceVector layer informationVector layer informationPolygon updatePolygon updateInterpolate (Average)Interpolate (Average)AlgorithmDialogRun as Batch Process…Run as Batch Process…Unmatching CRS'sUnmatching CRS'sUnable to execute algorithmUnable to execute algorithmProcessing algorithm…Processing algorithm…<b>Algorithm '{0}' starting…</b><b>Algorithm '{0}' starting…</b>Parameters do not all use the same CRS. This can cause unexpected results.
Do you want to continue?Parameters do not all use the same CRS. This can cause unexpected results.
Do you want to continue?Modify Selected FeaturesModify Selected FeaturesModify All FeaturesModify All FeaturesCancelCancelInput parameters:Input parameters:Execution completed in {0:0.2f} secondsExecution completed in {0:0.2f} secondsResults:Results:Execution failed after {0:0.2f} secondsExecution failed after {0:0.2f} secondsExecuting “{}”Executing “{}”Wrong or missing parameter value: {0}Wrong or missing parameter value: {0}Algorithm '{0}' finishedAlgorithm '{0}' finishedHTML output has been generated by this algorithm.
Open the results dialog to check it.HTML output has been generated by this algorithm.
Open the results dialog to check it.AlgorithmExecutorExecuting iteration {0}/{1}…Executing iteration {0}/{1}…AlgorithmLocatorFilterProcessing AlgorithmsProcessing AlgorithmsMissing dependencyMissing dependencyAnimation3DWidgetFormFormKeyframeKeyframeAdd keyframeAdd keyframe + + Remove keyframeRemove keyframe - - Edit keyframeEdit keyframe......Duplicate keyframeDuplicate keyframeInterpolationInterpolationLinearLinearInQuadInQuadOutQuadOutQuadInOutQuadInOutQuadOutInQuadOutInQuadInCubicInCubicOutCubicOutCubicInOutCubicInOutCubicOutInCubicOutInCubicInQuartInQuartOutQuartOutQuartInOutQuartInOutQuartOutInQuartOutInQuartInQuintInQuintOutQuintOutQuintInOutQuintInOutQuintOutInQuintOutInQuintInSineInSineOutSineOutSineInOutSineInOutSineOutInSineOutInSineInExpoInExpoOutExpoOutExpoInOutExpoInOutExpoOutInExpoOutInExpoInCircInCircOutCircOutCircInOutCircInOutCircOutInCircOutInCirc>>RepeatRepeatAspectRaster terrain analysisRaster terrain analysisElevation layerElevation layerZ factorZ factorAspectAspectAssignProjectionAssign projectionAssign projectionInput layerInput layerDesired CRSDesired CRSLayer with projectionLayer with projectionRaster projectionsRaster projectionsBarPlotGraphicsGraphicsInput layerInput layerCategory name fieldCategory name fieldValue fieldValue fieldBar plotBar plotHTML files (*.html)HTML files (*.html)BasicStatisticsForFieldstats,statistics,date,time,datetime,string,number,text,table,layer,sum,maximum,minimum,mean,average,standard,deviation,count,distinct,unique,variance,median,quartile,range,majority,minority,summarystats,statistics,date,time,datetime,string,number,text,table,layer,sum,maximum,minimum,mean,average,standard,deviation,count,distinct,unique,variance,median,quartile,range,majority,minority,summaryVector analysisVector analysisInput layerInput layerField to calculate statistics onField to calculate statistics onStatisticsStatisticsHTML files (*.html)HTML files (*.html)CountCountNumber of unique valuesNumber of unique valuesNumber of empty (null) valuesNumber of empty (null) valuesNumber of non-empty valuesNumber of non-empty valuesMinimum valueMinimum valueMaximum valueMaximum valueMinimum lengthMinimum lengthMaximum lengthMaximum lengthMean lengthMean lengthCoefficient of VariationCoefficient of VariationSumSumMean valueMean valueStandard deviationStandard deviationRangeRangeMedianMedianMinority (rarest occurring value)Minority (rarest occurring value)Majority (most frequently occurring value)Majority (most frequently occurring value)First quartileFirst quartileThird quartileThird quartileInterquartile Range (IQR)Interquartile Range (IQR)Basic statistics for fieldsBasic statistics for fieldsAnalyzed field: {}Analyzed field: {}Count: {}Count: {}Unique values: {}Unique values: {}NULL (missing) values: {}NULL (missing) values: {}Minimum value: {}Minimum value: {}Maximum value: {}Maximum value: {}Range: {}Range: {}Sum: {}Sum: {}Mean value: {}Mean value: {}Median value: {}Median value: {}Standard deviation: {}Standard deviation: {}Coefficient of Variation: {}Coefficient of Variation: {}Minority (rarest occurring value): {}Minority (rarest occurring value): {}Majority (most frequently occurring value): {}Majority (most frequently occurring value): {}First quartile: {}First quartile: {}Third quartile: {}Third quartile: {}Interquartile Range (IQR): {}Interquartile Range (IQR): {}Minimum length: {}Minimum length: {}Maximum length: {}Maximum length: {}Mean length: {}Mean length: {}BatchAlgorithmDialogBatch Processing - {0}Batch Processing - {0}Wrong or missing parameter value: {0} (row {1})Wrong or missing parameter value: {0} (row {1})Wrong or missing output value: {0} (row {1})Wrong or missing output value: {0} (row {1})Input parameters:Input parameters:
Processing algorithm {0}/{1}…
Processing algorithm {0}/{1}…<b>Algorithm {0} starting…</b><b>Algorithm {0} starting…</b>Algorithm {0} correctly executed…Algorithm {0} correctly executed…Execution completed in {0:0.2f} secondsExecution completed in {0:0.2f} secondsResults:Results:Batch execution completed in {0:0.2f} secondsBatch execution completed in {0:0.2f} secondsBatchInputSelectionPanelSelect from Open Layers…Select from Open Layers…Select from File System…Select from File System…Select FilesSelect FilesBatchOutputSelectionPanelSave FileSave FileOutput DirectoryOutput DirectoryBatchPanelLoad in QGISLoad in QGISOpen BatchOpen BatchWrong or missing parameter value: {0} (row {1})Wrong or missing parameter value: {0} (row {1})Wrong or missing output value: {0} (row {1})Wrong or missing output value: {0} (row {1})Save BatchSave BatchYesYesNoNoJSON files (*.json)JSON files (*.json)ErrorErrorAn error occurred while reading your file.An error occurred while reading your file.BooleanWidgetWrapperYesYesNoNoBoxPlotGraphicsGraphicsInput layerInput layerCategory name fieldCategory name fieldValue fieldValue fieldShow MeanShow MeanShow Standard DeviationShow Standard DeviationDon't show Mean and Standard DeviationDon't show Mean and Standard DeviationAdditional Statistic LinesAdditional Statistic LinesBox plotBox plotHTML files (*.html)HTML files (*.html)BufferInput layerInput layerGeometry column nameGeometry column nameBuffer distanceBuffer distanceDissolve by attributeDissolve by attributeDissolve all resultsDissolve all resultsProduce one feature for each geometry in any kind of geometry collection in the source fileProduce one feature for each geometry in any kind of geometry collection in the source fileAdditional creation optionsAdditional creation optionsBufferBufferBuffer vectorsBuffer vectorsVector geoprocessingVector geoprocessingCharacterWidget<p>Character: <span style="font-size: 24pt; font-family: %1">%2</span><p>Value: 0x%3<p>Character: <span style="font-size: 24pt; font-family: %1">%2</span><p>Value: 0x%3CheckValidityVector geometryVector geometryvalid,invalid,detectvalid,invalid,detectThe one selected in digitizing settingsThe one selected in digitizing settingsInput layerInput layerMethodMethodValid outputValid outputCount of valid featuresCount of valid featuresInvalid outputInvalid outputCount of invalid featuresCount of invalid featuresError outputError outputCount of errorsCount of errorsCheck validityCheck validityCheckboxesPanelSelect AllSelect AllClear SelectionClear SelectionClipRasterByExtentInput layerInput layerClipping extentClipping extentAssign a specified nodata value to output bandsAssign a specified nodata value to output bandsAdditional creation optionsAdditional creation optionsOutput data typeOutput data typeClipped (extent)Clipped (extent)Clip raster by extentClip raster by extentRaster extractionRaster extractionClipRasterByMaskInput layerInput layerMask layerMask layerAssign a specified nodata value to output bandsAssign a specified nodata value to output bandsCreate an output alpha bandCreate an output alpha bandMatch the extent of the clipped raster to the extent of the mask layerMatch the extent of the clipped raster to the extent of the mask layerKeep resolution of output rasterKeep resolution of output rasterAdditional creation optionsAdditional creation optionsOutput data typeOutput data typeClipped (mask)Clipped (mask)Clip raster by mask layerClip raster by mask layerRaster extractionRaster extractionClipVectorByExtentInput layerInput layerClipping extentClipping extentAdditional creation optionsAdditional creation optionsClipped (extent)Clipped (extent)Clip vector by extentClip vector by extentVector geoprocessingVector geoprocessingClipVectorByMaskInput layerInput layerMask layerMask layerAdditional creation optionsAdditional creation optionsClipped (mask)Clipped (mask)Clip vector by mask layerClip vector by mask layerVector geoprocessingVector geoprocessingColorReliefUse strict color matchingUse strict color matchingUse closest RGBA quadrupletUse closest RGBA quadrupletUse smoothly blended colorsUse smoothly blended colorsInput layerInput layerBand numberBand numberCompute edgesCompute edgesColor configuration fileColor configuration fileMatching modeMatching modeAdditional creation optionsAdditional creation optionsColor reliefColor reliefRaster analysisRaster analysisConcaveHullVector geometryVector geometryInput point layerInput point layerThreshold (0-1, where 1 is equivalent with Convex Hull)Threshold (0-1, where 1 is equivalent with Convex Hull)Allow holesAllow holesSplit multipart geometry into singleparts geometriesSplit multipart geometry into singleparts geometriesConcave hullConcave hullConcave hull (alpha shapes)Concave hull (alpha shapes)Creates a concave hull using the alpha shapes algorithm.Creates a concave hull using the alpha shapes algorithm.Creating Delaunay triangles…Creating Delaunay triangles…Computing edges max length…Computing edges max length…Removing features…Removing features…Dissolving Delaunay triangles…Dissolving Delaunay triangles…Saving data…Saving data…No Delaunay triangles created.No Delaunay triangles created.ConfigDialogSearch…Search…SettingSettingValueValueGeneralGeneralModelsModelsScriptsScriptsProvidersProvidersMenusMenusReset to defaultsReset to defaultsWrong value for parameter "{0}":
{1}Wrong value for parameter "{0}":
{1}Wrong valueWrong valueContextGeneratorIterate over this layer, creating a separate output for every feature in the layerIterate over this layer, creating a separate output for every feature in the layer (xmin, xmax, ymin, ymax) (xmin, xmax, ymin, ymax) (x, y) (x, y) [optional] [optional]DescriptionDescriptionShow advanced parametersShow advanced parameters[Enter name if this is a final result][Enter name if this is a final result]Parent algorithmsParent algorithmsHide advanced parametersHide advanced parameters'{0}' from algorithm '{1}''{0}' from algorithm '{1}'ErrorErrorWrong or missing value for parameter '{}'Wrong or missing value for parameter '{}'CoordinateCaptureCoordinate CaptureCoordinate CaptureClick on the map to view coordinates and capture to clipboard.Click on the map to view coordinates and capture to clipboard.Click to select the CRS to use for coordinate displayClick to select the CRS to use for coordinate displayCoordinate in your selected CRS (lat,lon or east,north)Coordinate in your selected CRS (lat,lon or east,north)Coordinate in map canvas coordinate reference system (lat,lon or east,north)Coordinate in map canvas coordinate reference system (lat,lon or east,north)Copy to ClipboardCopy to ClipboardClick to enable mouse tracking. Click the canvas to stopClick to enable mouse tracking. Click the canvas to stopStart captureStart captureClick to enable coordinate captureClick to enable coordinate captureCreateAttributeIndexVector generalVector generalInput LayerInput LayerAttribute to indexAttribute to indexIndexed layerIndexed layerCreate attribute indexCreate attribute indexCan not create attribute index on "{}"Can not create attribute index on "{}"Could not create attribute indexCould not create attribute indexLayer's data provider does not support creating attribute indexesLayer's data provider does not support creating attribute indexesCreateConstantRasterRaster toolsRaster toolsDesired extentDesired extentTarget CRSTarget CRSPixel sizePixel sizeConstant valueConstant valueConstantConstantCreate constant raster layerCreate constant raster layerCould not create raster output: {}Could not create raster output: {}Could not create raster output {}: {}Could not create raster output {}: {}CreateNewModelActionCreate New Model…Create New Model…ToolsToolsCreateNewScriptActionCreate New Script…Create New Script…ToolsToolsCrsWidgetWrapperSelect CRSSelect CRSDBManagerNo database selected or you are not connected to it.No database selected or you are not connected to it.Select the table you want export to file.Select the table you want export to file.Select a vector or a tabular layer you want export.Select a vector or a tabular layer you want export.Query ({0})Query ({0})Layer ({0})Layer ({0})QueryQueryDB ManagerDB ManagerInfoInfoTableTablePreviewPreviewProvidersProviders&Database&Database&Schema&Schema&Table&TableDefaultDefault&Refresh&Refresh&SQL Window&SQL Window&Import Layer/File…&Import Layer/File…&Export to File…&Export to File…&Exit&ExitDBManagerPluginUnable to find a valid unique fieldUnable to find a valid unique fieldCopyCopyDB ManagerDB ManagerSelect an empty schema for deletion.Select an empty schema for deletion.Select a table/view for deletion.Select a table/view for deletion.Select a table to empty it.Select a table to empty it.Select a table/view.Select a table/view.Server version: Server version: Host:Host:User:User:Library:Library:<warning> geometry_columns table doesn't exist!
This table is essential for many GIS applications for enumeration of tables.<warning> geometry_columns table doesn't exist!
This table is essential for many GIS applications for enumeration of tables.create new schemascreate new schemascreate temporary tablescreate temporary tablesNot connectedNot connectedConnection detailsConnection detailsGeneral infoGeneral info<warning> This user has no privileges!<warning> This user has no privileges!User has privileges:User has privileges:PrivilegesPrivilegesOwner:Owner:Comment:Comment:Materialized View informationMaterialized View informationcreate new objectscreate new objectsaccess objectsaccess objectsSchema detailsSchema details<warning> This user has no privileges to access this schema!<warning> This user has no privileges to access this schema!Relation type:Relation type:ViewViewTableTableRows:Rows:Unknown (<a href="action:rows/count">find out</a>)Unknown (<a href="action:rows/count">find out</a>)NameNameTypeTypeNullNullDefaultDefaultColumn(s)Column(s)FunctionFunction<warning> This is not a spatial table.<warning> This is not a spatial table.FieldsFieldsConstraintsConstraintsIndexesIndexesTriggersTriggersView definitionView definitionColumn:Column:&Delete (Empty) Schema…&Delete (Empty) Schema…Geometry:Geometry:Qgis Geometry type:Qgis Geometry type:Dimension:Dimension:UndefinedUndefinedSpatial ref:Spatial ref:Estimated extent:Estimated extent:(unknown) (<a href="action:extent/get">find out</a>)(unknown) (<a href="action:extent/get">find out</a>)Extent:Extent:<warning> {0} support not enabled!<warning> {0} support not enabled!<warning> No spatial index defined (<a href="action:spatialindex/create">create it</a>)<warning> No spatial index defined (<a href="action:spatialindex/create">create it</a>)Materialized viewMaterialized view&Create Schema…&Create Schema…&Delete (Empty) Schema&Delete (Empty) SchemaDelete Selected ItemDelete Selected Item&Create Table…&Create Table…&Edit Table…&Edit Table…&Delete Table/View…&Delete Table/View…&Empty Table…&Empty Table…&Move to Schema&Move to Schema&Change Logging…&Change Logging…Pages:Pages:Rows (estimation):Rows (estimation):Privileges:Privileges:<warning> This user doesn't have usage privileges for this schema!<warning> This user doesn't have usage privileges for this schema!Rows (counted):Rows (counted):<warning> This user has read-only privileges.<warning> This user has read-only privileges.<warning> There's a significant difference between estimated and real row count. Consider running <a href="action:vacuumanalyze/run">VACUUM ANALYZE</a>.<warning> There's a significant difference between estimated and real row count. Consider running <a href="action:vacuumanalyze/run">VACUUM ANALYZE</a>.<warning> No primary key defined for this table!<warning> No primary key defined for this table!Scripts:Scripts:<warning> Version of installed scripts doesn't match version of released scripts!
This is probably a result of incorrect PostGIS upgrade.<warning> Version of installed scripts doesn't match version of released scripts!
This is probably a result of incorrect PostGIS upgrade.<warning> This user doesn't have privileges to read contents of geometry_columns table!
This table is essential for many GIS applications for enumeration of tables.<warning> This user doesn't have privileges to read contents of geometry_columns table!
This table is essential for many GIS applications for enumeration of tables.LengthLengthEnabledEnabledYesYesNoNo<a href="action:triggers/enable">Enable all triggers</a> / <a href="action:triggers/disable">Disable all triggers</a><a href="action:triggers/enable">Enable all triggers</a> / <a href="action:triggers/disable">Disable all triggers</a>DefinitionDefinitionRulesRules&Table&Table"{0}" not found"{0}" not foundFilename:Filename:SQLite version:SQLite version:&Re-connect&Re-connect&Database&Database&Schema&SchemaCannot delete the selected item.Cannot delete the selected item.No database selected or you are not connected to it.No database selected or you are not connected to it.New schemaNew schemaEnter new schema nameEnter new schema nameTable triggersTable triggersTable triggerTable triggerSpatial IndexSpatial IndexCheckCheckPrimary keyPrimary keyForeign keyForeign keyUniqueUniqueExclusionExclusionUnknownUnknownTable IndexTable IndexDatabase:Database:{0} is not supported yet{0} is not supported yetError:
{0}Error:
{0}
Query:
{0}
Query:
{0}Really remove connection to {0}?Really remove connection to {0}?Really delete schema {0}?Really delete schema {0}?Select a table to edit.Select a table to edit.Really delete table/view {0}?Really delete table/view {0}?Really delete all items from table {0}?Really delete all items from table {0}?Do you want to {0} all triggers?Do you want to {0} all triggers?Do you want to {0} trigger {1}?Do you want to {0} trigger {1}?Do you want to {0} spatial index for field {1}?Do you want to {0} spatial index for field {1}?SQLite list tables cache:SQLite list tables cache:Oracle Spatial:Oracle Spatial:Object type:Object type:Creation Date:Creation Date:Last Modification Date:Last Modification Date:CommentCommentColumnColumnStatusStatusValidatedValidatedGeneratedGeneratedCheck conditionCheck conditionForeign TableForeign TableForeign columnForeign columnOn DeleteOn DeleteIndex TypeIndex TypeLast analyzedLast analyzedCompressionCompressionUniquenessUniquenessActionActionEventEventRefresh Mode:Refresh Mode:Refresh Method:Refresh Method:Build Mode:Build Mode:Last Refresh Date:Last Refresh Date:Last Refresh Type:Last Refresh Type:Fast Refreshable:Fast Refreshable:Staleness:Staleness:Stale since:Stale since:Compile State:Compile State:Use no index:Use no index:Executing SQLExecuting SQLDB Manager…DB Manager…Update SQL Layer…Update SQL Layer…<warning> There is no entry in geometry_columns!<warning> There is no entry in geometry_columns!DBModelDatabasesDatabasesInvalid layerInvalid layerUnable to load the layer {0}Unable to load the layer {0}DBTreeRename…Rename…Delete…Delete…Add to CanvasAdd to CanvasRe-connectRe-connectRemoveRemoveNew Connection…New Connection…%1 is an invalid layer - not loaded%1 is an invalid layer - not loaded%1 is an invalid layer and cannot be loaded. Please check the <a href="#messageLog">message log</a> for further info.%1 is an invalid layer and cannot be loaded. Please check the <a href="#messageLog">message log</a> for further info.Datasources2VrtVector generalVector generalInput datasourcesInput datasourcesCreate "unioned" VRTCreate "unioned" VRTDbManagerDlgAddGeometryColumnAdd geometry columnAdd geometry columnNameNameTypeTypeDimensionsDimensionsSRIDSRIDDbManagerDlgCreateConstraintAdd constraintAdd constraintColumnColumnPrimary keyPrimary keyUniqueUniqueDbManagerDlgCreateIndexCreate indexCreate indexColumnColumnNameNameDbManagerDlgCreateTableCreate TableCreate TableSchemaSchemaNameNameAdd fieldAdd fieldDelete fieldDelete fieldUpUpDownDownPrimary keyPrimary keyCreate geometry columnCreate geometry columnDimensionsDimensionsSRIDSRIDCreate spatial indexCreate spatial indexDbManagerDlgDbErrorDatabase ErrorDatabase ErrorAn error occurredAn error occurredAn error occurred when executing a queryAn error occurred when executing a queryQueryQueryDbManagerDlgExportVectorExport to vector fileExport to vector fileSave asSave asOptionsOptionsReplace destination file (if exists)Replace destination file (if exists)Source SRIDSource SRIDTarget SRIDTarget SRIDEncodingEncoding……FormatFormatDbManagerDlgFieldPropertiesField propertiesField propertiesNameNameTypeTypeCan be NULLCan be NULLDefault value expressionDefault value expression<html><head/><body><p>Properly quoted PostgreSQL expression (e.g. <code>4</code>, <code>'text'</code> or <code>nextval('foo_id_seq')</code><br/></p></body></html><html><head/><body><p>Properly quoted PostgreSQL expression (e.g. <code>4</code>, <code>'text'</code> or <code>nextval('foo_id_seq')</code><br/></p></body></html>LengthLengthDbManagerDlgImportVectorImport vector layerImport vector layerInputInput……Import only selected featuresImport only selected featuresUpdate optionsUpdate optionsOutput tableOutput tableSchemaSchemaTableTableOptionsOptionsPrimary keyPrimary keyGeometry columnGeometry columnSource SRIDSource SRIDTarget SRIDTarget SRIDEncodingEncodingCreate single-part geometries instead of multi-partCreate single-part geometries instead of multi-partCreate spatial indexCreate spatial indexReplace destination table (if exists)Replace destination table (if exists)Convert field names to lowercaseConvert field names to lowercaseDbManagerDlgSqlLayerWindow<html><head/><body><p>Avoid selecting feature by id. Sometimes - especially when running expensive queries/views - fetching the data sequentially instead of fetching features by id can be much quicker.</p></body></html><html><head/><body><p>Avoid selecting feature by id. Sometimes - especially when running expensive queries/views - fetching the data sequentially instead of fetching features by id can be much quicker.</p></body></html>Avoid selecting by feature idAvoid selecting by feature idUpdateUpdateNameNameDeleteDelete&Clear&ClearColumn(s) with
unique valuesColumn(s) with
unique valuesGeometry columnGeometry columnRetrieve
columnsRetrieve
columnsSQL WindowSQL WindowSaved querySaved querySaveSaveExecute query (Ctrl+R)Execute query (Ctrl+R)ExecuteExecuteCtrl+RCtrl+RLayer name (prefix)Layer name (prefix)TypeTypeVectorVectorRasterRasterSet filterSet filterDbManagerDlgSqlWindowColumn(s) with
unique valuesColumn(s) with
unique valuesSet filterSet filterDeleteDeleteCreate a viewCreate a view&Clear&ClearLoad as new layerLoad as new layerGeometry columnGeometry columnRetrieve
columnsRetrieve
columnsSQL WindowSQL WindowQueryQueryRows affectedRows affectedDuration (secs)Duration (secs)Query HistoryQuery HistoryLoadLoadLayer name (prefix)Layer name (prefix)TypeTypeVectorVectorRasterRasterSaved querySaved querySaveSaveExecute query (Ctrl+R)Execute query (Ctrl+R)ExecuteExecuteCtrl+RCtrl+RCancel query (ESC)Cancel query (ESC)CancelCancel<html><head/><body><p>Avoid selecting feature by id. Sometimes - especially when running expensive queries/views - fetching the data sequentially instead of fetching features by id can be much quicker.</p></body></html><html><head/><body><p>Avoid selecting feature by id. Sometimes - especially when running expensive queries/views - fetching the data sequentially instead of fetching features by id can be much quicker.</p></body></html>Avoid selecting by feature idAvoid selecting by feature idNameNameDbManagerDlgTablePropertiesTable propertiesTable propertiesColumnsColumnsTable columns:Table columns:Add columnAdd columnAdd geometry columnAdd geometry columnEdit columnEdit columnDelete columnDelete columnConstraintsConstraintsPrimary, foreign keys, unique and check constraints:Primary, foreign keys, unique and check constraints:Add primary key / uniqueAdd primary key / uniqueDelete constraintDelete constraintIndexesIndexesIndexes defined for this table:Indexes defined for this table:Add indexAdd indexAdd spatial indexAdd spatial indexDelete indexDelete indexDbManagerQueryBuilderDlgColumnsColumnsGroup byGroup byOrder byOrder byDataDataShow system tablesShow system tablesTablesTablesSQL Query BuilderSQL Query BuilderWhereWhereAggregatesAggregatesFunctionsFunctionsMathMathStrings functionsStrings functionsOperatorsOperatorsColumns' valuesColumns' valuesOnly 10 first valuesOnly 10 first valuesSpatial indexSpatial indexTable (with spatial index)Table (with spatial index)Table (Target)Table (Target)Use spatial indexUse spatial index&Reset&ResetDefineProjectionVector generalVector generalInput LayerInput LayerLayer with projectionLayer with projectionDefine layer projectionDefine layer projectionData source isn't a shapefile, skipping .prj/.qpj creationData source isn't a shapefile, skipping .prj/.qpj creationDelaunayVector geometryVector geometryInput layerInput layerDelaunay triangulationDelaunay triangulationInput file should contain at least 3 points. Choose another file and try again.Input file should contain at least 3 points. Choose another file and try again.DeleteColumndrop,delete,remove,fields,columns,attributesdrop,delete,remove,fields,columns,attributesVector tableVector tableFields to dropFields to dropDrop field(s)Drop field(s)Remaining fieldsRemaining fieldsField “{}” does not exist in input layerField “{}” does not exist in input layerDeleteDuplicateGeometriesVector generalVector generalInput layerInput layerCleanedCleanedDelete duplicate geometriesDelete duplicate geometriesDeleteModelActionDelete Model…Delete Model…Are you sure you want to delete this model from the current project?DeleteModelActionAre you sure you want to delete this model from the current project?Delete ModelDeleteModelActionDelete ModelAre you sure you want to delete this model?DeleteModelActionAre you sure you want to delete this model?DeletePreconfiguredAlgorithmActionDelete Preconfigured Algorithm…Delete Preconfigured Algorithm…Delete AlgorithmDeletePreconfiguredAlgorithmActionDelete AlgorithmAre you sure you want to delete this algorithm?DeletePreconfiguredAlgorithmActionAre you sure you want to delete this algorithm?DeleteScriptActionDelete Script…Delete Script…Delete ScriptDelete ScriptAre you sure you want to delete this script?Are you sure you want to delete this script?Can not find corresponding script file.Can not find corresponding script file.DensifyGeometriesadd,vertex,vertices,points,nodesadd,vertex,vertices,points,nodesVector geometryVector geometryVertices to addVertices to addDensify by countDensify by countDensifiedDensifiedDensifyGeometriesIntervaladd,vertex,vertices,points,nodesadd,vertex,vertices,points,nodesVector geometryVector geometryInterval between vertices to addInterval between vertices to addDensify by intervalDensify by intervalDensifiedDensifiedDestinationSelectionPanel[Save to temporary file][Save to temporary file][Save to temporary folder][Save to temporary folder][Create temporary layer][Create temporary layer][Skip output][Skip output]Save to GeoPackage…Save to GeoPackage…Skip OutputSkip OutputCreate Temporary LayerCreate Temporary LayerSave to a Temporary FileSave to a Temporary FileSave to File…Save to File…Save to PostGIS Table…Save to PostGIS Table…Change File Encoding ({})…Change File Encoding ({})…GeoPackage files (*.gpkg);;All files (*.*)OutputFileGeoPackage files (*.gpkg);;All files (*.*)Save to GeoPackageSave to GeoPackageLayer nameLayer nameSave fileSave fileFile encodingFile encodingSelect DirectorySelect DirectoryDialogParametersParametersDialogDialogLogLogCancelCancel output table output tableSelect connection and schemaSelect connection and schemaTable nameTable nameNew expressionNew expressionNameNameExpressionExpressionPredefined formulaPredefined formulaVariablesVariablesDirectorySelectorDialogAddAddRemoveRemoveRemove allRemove allSelect directorySelect directoryDissolveInput layerInput layerDissolve fieldDissolve fieldGeometry column nameGeometry column nameProduce one feature for each geometry in any kind of geometry collection in the source fileProduce one feature for each geometry in any kind of geometry collection in the source fileKeep input attributesKeep input attributesCount dissolved featuresCount dissolved featuresCompute area and perimeter of dissolved featuresCompute area and perimeter of dissolved featuresCompute min/max/sum/mean for attributeCompute min/max/sum/mean for attributeNumeric attribute to calculate statistics onNumeric attribute to calculate statistics onAdditional creation optionsAdditional creation optionsDissolvedDissolvedDissolveDissolveVector geoprocessingVector geoprocessingDistanceInputPanelDistance is in geographic degrees. Consider reprojecting to a projected local coordinate system for accurate results.Distance is in geographic degrees. Consider reprojecting to a projected local coordinate system for accurate results.DlgAddGeometryColumnDB ManagerDB ManagerField name must not be empty.Field name must not be empty.DlgAutofillAutofill settingsAutofill settingsAutofill modeAutofill modeDo not autofillDo not autofillFill with numbersFill with numbersFill with parameter valuesFill with parameter valuesParameter to useParameter to useDlgCancelTaskQueryDialogDialogExecuting SQL...Executing SQL...CancelCancelDlgConfigProcessing optionsProcessing optionsEnter setting name to filter listEnter setting name to filter listDlgCreateIndexErrorErrorPlease enter a name for the index.Please enter a name for the index.DlgCreateTable&Create&CreateDB ManagerDB ManagerNo field selected.No field selected.Field is already at the top.Field is already at the top.Field is already at the bottom.Field is already at the bottom.A valid schema must be selected first.A valid schema must be selected first.A valid table name is required.A valid table name is required.At least one field is required.At least one field is required.A name is required for the geometry column.A name is required for the geometry column.Table created successfully.Table created successfully.DlgExportVectorChoose where to save the fileChoose where to save the fileExport to fileExport to fileOutput file name is requiredOutput file name is requiredInvalid source srid: must be an integerInvalid source srid: must be an integerInvalid target srid: must be an integerInvalid target srid: must be an integerError {0}
{1}Error {0}
{1}Export finished.Export finished.DlgFieldPropertiesDB ManagerDB ManagerField name must not be empty.Field name must not be empty.Field type must not be empty.Field type must not be empty.DlgFixedTableFixed tableFixed tableDlgHelpEditionHelp EditorHelp EditorSelect element to editSelect element to editElement descriptionElement descriptionDlgHistoryHistoryHistoryDlgImportVectorChoose the file to importChoose the file to importImport to DatabaseImport to DatabaseInput layer missing or not valid.Input layer missing or not valid.Output table name is required.Output table name is required.Invalid source srid: must be a valid crs.Invalid source srid: must be a valid crs.Invalid target srid: must be a valid crs.Invalid target srid: must be a valid crs.Error {0}
{1}Error {0}
{1}Import was successful.Import was successful.DlgModelerExport as imageExport as imageExport as Python scriptExport as Python scriptEdit model helpEdit model helpProcessing ModelerProcessing ModelerNavigationNavigationOpen model...Open model...Open model (Ctrl+O)Open model (Ctrl+O)Ctrl+OCtrl+OSave modelSave modelSave model (Ctrl+S)Save model (Ctrl+S)Ctrl+SCtrl+SSave model as...Save model as...Save model as (Ctrl+S)Save model as (Ctrl+S)Ctrl+Shift+SCtrl+Shift+SZoom to &100%Zoom to &100%Ctrl+1Ctrl+1Zoom inZoom inCtrl++Ctrl++Zoom outZoom outCtrl+-Ctrl+-Export as image...Export as image...Zoom fullZoom fullCtrl+0Ctrl+0Export as PDF...Export as PDF...Export as PDFExport as PDFExport as SVG...Export as SVG...Export as SVGExport as SVGExport as Python script...Export as Python script...Edit model help...Edit model help...Run model...Run model...Run model (F5)Run model (F5)F5F5Save model in projectSave model in projectDlgMultipleSelectionMultiple selectionMultiple selectionDlgNumberInputEnter number or expressionEnter number or expression<html><head/><body><p>Enter expression in the text field. Double-click on elements in the tree to add their values to the expression.</p></body></html><html><head/><body><p>Enter expression in the text field. Double-click on elements in the tree to add their values to the expression.</p></body></html><html><head/><body><p><span style=" font-weight:600;">Warning</span>: if expression result is float value, but integer required, result will be rounded to integer.</p></body></html><html><head/><body><p><span style=" font-weight:600;">Warning</span>: if expression result is float value, but integer required, result will be rounded to integer.</p></body></html>DlgRenderingStylesDialogDialogOutputOutputStyleStyleDlgSqlLayerWindowColumn(s) with unique valuesColumn(s) with unique valuesColumn with unique valuesColumn with unique values{0} rows, {1:.3f} seconds{0} rows, {1:.1f} seconds {0}?} {1:.3f?}DlgSqlWindow{0} - {1} [{2}]{0} - {1} [{2}]Column(s) with unique valuesColumn(s) with unique valuesColumn with unique valuesColumn with unique valuesCancel (ESC)Cancel (ESC){0} rows, {1:.3f} seconds{0} rows, {1:.1f} seconds {0}?} {1:.3f?}DlgTablePropertiesDB ManagerDB ManagerNo columns were selected.No columns were selected.Delete ColumnDelete ColumnAre you sure you want to delete column '{0}'?Are you sure you want to delete column '{0}'?Delete ConstraintDelete ConstraintAre you sure you want to delete constraint '{0}'?Are you sure you want to delete constraint '{0}'?No constraints were selected.No constraints were selected.The selected table has no geometry.The selected table has no geometry.Create Spatial IndexCreate Spatial IndexCreate spatial index for field {0}?Create spatial index for field {0}?No indices were selected.No indices were selected.Delete IndexDelete IndexAre you sure you want to delete index '{0}'?Are you sure you want to delete index '{0}'?DlgVersioningSchemaSchemaTableTableNew columnsNew columnsAdd Change Logging Support to a TableAdd Change Logging Support to a TableTable should be empty, with a primary keyTable should be empty, with a primary keyCreate a view with current content (<TABLE>_current)Create a view with current content (<TABLE>_current)Primary keyPrimary keyid_histid_histStart timeStart timetime_starttime_startEnd timeEnd timetime_endtime_endUser roleUser roleuser_roleuser_roleSQL to be executedSQL to be executedDnDTreeBase configurationBase configurationConfigure ContainerConfigure ContainerControl visibility by expressionControl visibility by expressionVisibility ExpressionVisibility ExpressionTitleTitleColumn countColumn countShow as group boxShow as group boxConfigure Relation EditorConfigure Relation EditorShow link buttonShow link buttonShow unlink buttonShow unlink buttonConfigure QML WidgetConfigure QML WidgetInsert QML code here...Insert QML code here...Free text...Free text...RectangleRectanglePie chartPie chartBar chartBar chartQML CodeQML CodeConfigure FieldConfigure FieldDockWidgetResults ViewerResults ViewerDualEdgeTriangulationReading points…Reading points…WarningWarningFile could not be written.File could not be written.EditModelActionEdit Model…Edit Model…EditScriptActionEdit Script…Edit Script…Edit ScriptEdit ScriptCan not find corresponding script file.Can not find corresponding script file.EffectPropertiesWidgetFormFormEffect typeEffect typeThis effect doesn't have any editable propertiesThis effect doesn't have any editable propertiesEliminateSelectionVector geometryVector geometryLargest AreaLargest AreaSmallest AreaSmallest AreaLargest Common BoundaryLargest Common BoundaryInput layerInput layerMerge selection with the neighbouring polygon with theMerge selection with the neighbouring polygon with theEliminatedEliminatedEliminate selected polygonsEliminate selected polygons{0}: (No selection in input layer "{1}"){0}: (No selection in input layer "{1}")Could not replace geometry of feature with id {0}Could not replace geometry of feature with id {0}Could not commit changesCould not commit changesEnumModelerWidgetClear?Clear?Are you sure you want to delete all items?Are you sure you want to delete all items?ExampleAlgorithmCreate copy of layerCreate copy of layerAlgorithms for vector layersAlgorithms for vector layersInput layerInput layerOutput layer with selected featuresOutput layer with selected featuresExampleProcessingAlgorithmMy ScriptMy ScriptExample scriptsExample scriptsExample algorithm short descriptionExample algorithm short descriptionInput layerInput layerOutput layerOutput layerExecuteSQLExecute SQLExecute SQLVector generalVector generalAdditional input datasources (called input1, .., inputN in the query)Additional input datasources (called input1, .., inputN in the query)SQL querySQL queryUnique identifier fieldUnique identifier fieldGeometry fieldGeometry fieldAutodetectAutodetectNo geometryNo geometryGeometry typeGeometry typeCRSCRSSQL OutputSQL OutputEmpty SQL. Please enter valid SQL expression and try again.Empty SQL. Please enter valid SQL expression and try again.ExecuteSqlNoneNoneOGR SQLOGR SQLSQLiteSQLiteInput layerInput layerSQL expressionSQL expressionSQL dialectSQL dialectAdditional creation optionsAdditional creation optionsSQL resultSQL resultExecute SQLExecute SQLVector miscellaneousVector miscellaneousEmpty SQL. Please enter valid SQL expression and try again.Empty SQL. Please enter valid SQL expression and try again.ExportGeometryInfoexport,add,information,measurements,areas,lengths,perimeters,latitudes,longitudes,x,y,z,extract,points,lines,polygons,sinuosity,fieldsexport,add,information,measurements,areas,lengths,perimeters,latitudes,longitudes,x,y,z,extract,points,lines,polygons,sinuosity,fieldsVector geometryVector geometryLayer CRSLayer CRSProject CRSProject CRSEllipsoidalEllipsoidalInput layerInput layerCalculate usingCalculate usingAdded geom infoAdded geom infoAdd geometry attributesAdd geometry attributesExtentFromLayerpolygon,from,vector,raster,extent,envelope,bounds,bounding,boundary,layerpolygon,from,vector,raster,extent,envelope,bounds,bounding,boundary,layerLayer toolsLayer toolsInput layerInput layerExtract layer extentExtract layer extentExtentExtentExtentSelectionPanel[Leave blank to use min covering extent][Leave blank to use min covering extent]Use Canvas ExtentUse Canvas ExtentUse Layer Extent…Use Layer Extent…Select Extent on CanvasSelect Extent on CanvasUse Min Covering Extent from Input LayersUse Min Covering Extent from Input LayersSelect ExtentSelect ExtentUse extent fromUse extent fromExtractProjectionInput fileInput fileCreate also .prj fileCreate also .prj fileExtract projectionExtract projectionRaster projectionsRaster projectionsExtractSpecificVerticesVector geometryVector geometryInput layerInput layerVertex indicesVertex indicesVerticesVerticesExtract specific verticesExtract specific verticespoints,vertex,nodespoints,vertex,nodes'{}' is not a valid vertex index'{}' is not a valid vertex indexFeatureSourceWidgetWrapperSelect fileSelect fileSelected features onlySelected features onlyFieldsCalculatorField calculatorField calculatorCreate a new fieldCreate a new fieldOutput field nameOutput field nameOutput field typeOutput field typeOutput field widthOutput field widthWidth of complete output. For example 123,456 means 6 as field width.Width of complete output. For example 123,456 means 6 as field width.PrecisionPrecisionInput layerInput layerUpdate existing fieldUpdate existing fieldOutput fileOutput file......Vector tableVector tableFloatFloatIntegerIntegerStringStringDateDateResult field nameResult field nameField typeField typeField lengthField lengthField precisionField precisionCreate new fieldCreate new fieldFormulaFormulaCalculatedCalculatedField name is not set. Please enter a field nameField name is not set. Please enter a field nameFieldsCalculatorDialog[Save to temporary file][Save to temporary file]Save fileSave fileUnable to execute algorithmUnable to execute algorithmProcessingProcessingFieldsMapperattributes,tableattributes,tableFields mappingFields mappingRefactoredRefactoredParser error in expression "{}": {}Parser error in expression "{}": {}Evaluation error in expression "{}": {}Evaluation error in expression "{}": {}Refactor fieldsRefactor fieldsVector tableVector tableFieldsMappingModelSource expressionSource expressionField nameField nameTypeTypeLengthLengthPrecisionPrecisionFieldsMappingPanelDo you want to reset the field mapping?Do you want to reset the field mapping?FieldsPyculatorVector tableVector tableIntegerIntegerFloatFloatStringStringInput layerInput layerResult field nameResult field nameField typeField typeField lengthField lengthField precisionField precisionGlobal expressionGlobal expressionFormulaFormulaCalculatedCalculatedFieldPyculator code execute error.Global code block can't be executed!
{0}
{1}FieldPyculator code execute error.Global code block can't be executed!
{0}
{1}FieldPyculator code execute error. Field code block can't be executed!
{0}
{1}FieldPyculator code execute error. Field code block can't be executed!
{0}
{1}FieldPyculator code execute error
Field code block does not return '{0}' variable! Please declare this variable in your code!FieldPyculator code execute error
Field code block does not return '{0}' variable! Please declare this variable in your code!Advanced Python field calculatorAdvanced Python field calculatorFileDirectorySelectorSelect directorySelect directorySelect fileSelect fileAll files (*.*)All files (*.*)FileSelectionPanelSelect FolderSelect FolderSelect FileSelect File{} files{} files);;All files (*.*));;All files (*.*)FileWidgetWrapperSelect fileSelect file{} files{} files);;All files (*.*));;All files (*.*)All files (*.*)All files (*.*)Select FileSelect FileFindProjectioncrs,srs,coordinate,reference,system,guess,estimate,finder,determinecrs,srs,coordinate,reference,system,guess,estimate,finder,determineVector generalVector generalInput layerInput layerTarget area for layerTarget area for layerCRS candidatesCRS candidatesFind projectionFind projectionFound candidate CRS: {}Found candidate CRS: {}No matching projections foundNo matching projections foundFixedTableDialogAdd rowAdd rowRemove row(s)Remove row(s)Remove allRemove allFixedTablePanelFixed table {0}x{1}Fixed table {0}x{1}FormFormFormInsertInsert((sqrtsqrt))^^--//>>**ANDAND<=<=LayersLayersOperatorsOperatorsacosacosasinasin<<sinsintantan>=>=atanatancoscoslog10log10ORORlnlnAdd…Add…Save…Save…==!=!=++ExpressionExpressionPredefined expressionsPredefined expressionsVector layerVector layerInterpolation attributeInterpolation attributeAttributeAttributeTypeTypeUse Z-coordinate for interpolationUse Z-coordinate for interpolation......Toggle advanced modeToggle advanced modeLower boundLower boundUpper boundUpper boundColorColorAdd rowAdd rowRemove rowRemove rowMove upMove upMove downMove downLoad colors from fileLoad colors from fileSave colors to fileSave colors to fileGenerate color table automaticallyGenerate color table automaticallyRemove row(s)Remove row(s)OpenOpenSaveSaveLoad layers on completionLoad layers on completionIterate over this layerIterate over this layerAdvanced parametersAdvanced parametersMinMinMaxMaxFieldsFieldsAdd new fieldAdd new fieldaddaddDelete selected fieldDelete selected fielddeletedeleteMove selected field upMove selected field upupupMove selected field downMove selected field downdowndownReset all fieldsReset all fieldsresetresetLoad fields from layerLoad fields from layerLoad fields from selected layerLoad fields from selected layerLoad fieldsLoad fieldsequalsequalscontainscontainstouchestouchesintersectsintersectswithinwithinoverlapsoverlapscrossescrossesdisjointdisjointNumber of rows (pixels) in output rasterNumber of rows (pixels) in output rasterColumnsColumnsResolution of each pixel in output raster, in layer unitsResolution of each pixel in output raster, in layer unitsPixel size XPixel size XNumber of columns (pixels) in output rasterNumber of columns (pixels) in output rasterRowsRowsPixel size YPixel size Y……Remove itemRemove itemAdd itemAdd itemClear allClear allAllow multiple selectionAllow multiple selectionFixed number of rowsFixed number of rowsAdd columnAdd columnRemove columnRemove columnGPKGDBPluginThere is no defined database connection "{0}".There is no defined database connection "{0}".GPKGDatabaseRun &VacuumRun &Vacuum&Database&DatabaseNo database selected or you are not connected to it.No database selected or you are not connected to it.GdalAlgorithmProviderActivateActivateLocation of GDAL docsLocation of GDAL docsGdalParametersPanelGDAL/OGR console callGDAL/OGR console call[temporary file][temporary file]Invalid value for parameter '{0}'Invalid value for parameter '{0}'GeometryByExpressionVector geometryVector geometryPolygonPolygonOutput geometry typeOutput geometry typeOutput geometry has z dimensionOutput geometry has z dimensionOutput geometry has m valuesOutput geometry has m valuesGeometry expressionGeometry expressionGeometry by expressionGeometry by expressionModified geometryModified geometryEvaluation error: {0}Evaluation error: {0}{} is not a geometry{} is not a geometryGeometryConvertVector geometryVector geometryCentroidsCentroidsNodesNodesLinestringsLinestringsMultilinestringsMultilinestringsPolygonsPolygonsInput layerInput layerNew geometry typeNew geometry typeConvertedConvertedCannot convert from {0} to LineStringsCannot convert from {0} to LineStringsCannot convert from {0} to MultiLineStringsCannot convert from {0} to MultiLineStringsCannot convert from Point to PolygonCannot convert from Point to PolygonConvert geometry typeConvert geometry typeGeometryGeneratorWidgetBaseFormFormGeometry typeGeometry typeGlobePluginLaunch GlobeLaunch Globe&Globe&GlobeGrass7AlgorithmCould not open GRASS GIS 7 algorithm: {0}
{1}Could not open GRASS GIS 7 algorithm: {0}
{1}ProcessingProcessingGRASS GIS 7 region extentGRASS GIS 7 region extentGRASS GIS 7 region cellsize (leave 0 for default)GRASS GIS 7 region cellsize (leave 0 for default)Output Rasters format options (createopt)Output Rasters format options (createopt)Output Rasters format metadata options (metaopt)Output Rasters format metadata options (metaopt)v.in.ogr snap tolerance (-1 = no snap)v.in.ogr snap tolerance (-1 = no snap)v.in.ogr min areav.in.ogr min areav.out.ogr output typev.out.ogr output typev.out.ogr output data source options (dsco)v.out.ogr output data source options (dsco)v.out.ogr output layer options (lco)v.out.ogr output layer options (lco)GRASS GIS 7 folder is not configured. Please configure it before running GRASS GIS 7 algorithms.GRASS GIS 7 folder is not configured. Please configure it before running GRASS GIS 7 algorithms.GRASS GIS 7 execution commandsGRASS GIS 7 execution commandsprocessInputs end. Commands: {}processInputs end. Commands: {}processCommands end. Commands: {}processCommands end. Commands: {}Grass7AlgorithmProviderActivateActivateGRASS7 folderGRASS7 folderLog execution commandsLog execution commandsLog console outputLog console outputLocation of GRASS docsLocation of GRASS docsFor vector layers, use v.external (faster) instead of v.in.ogrFor vector layers, use v.external (faster) instead of v.in.ogrCould not open GRASS GIS 7 algorithm: {0}Could not open GRASS GIS 7 algorithm: {0}ProcessingProcessingCould not open GRASS GIS 7 algorithm: {0}
{1}Could not open GRASS GIS 7 algorithm: {0}
{1}Grass7UtilsGRASS GIS 7 execution console outputGRASS GIS 7 execution console outputGRASS GIS 7 folder is not configured. Please configure it before running GRASS GIS 7 algorithms.GRASS GIS 7 folder is not configured. Please configure it before running GRASS GIS 7 algorithms.GRASS GIS 7 binary {0} can't be found on this system from a shell. Please install it or configure your PATH {1} environment variable.GRASS GIS 7 binary {0} can't be found on this system from a shell. Please install it or configure your PATH {1} environment variable.GRASS 7 can't be found on this system from a shell. Please install it or configure your PATH environment variable.GRASS 7 can't be found on this system from a shell. Please install it or configure your PATH environment variable.The specified GRASS 7 folder "{}" does not contain a valid set of GRASS 7 modules.
Please, go to the Processing settings dialog, and check that the GRASS 7
folder is correctly configuredThe specified GRASS 7 folder "{}" does not contain a valid set of GRASS 7 modules.
Please, go to the Processing settings dialog, and check that the GRASS 7
folder is correctly configuredGrassAlgorithmr.horizon.height - Horizon angle computation from a digital elevation model.r.horizon.height - Horizon angle computation from a digital elevation model.r.sunmask.datetime - Calculates cast shadow areas from sun position and elevation raster map.r.sunmask.datetime - Calculates cast shadow areas from sun position and elevation raster map.r.sunmask.position - Calculates cast shadow areas from sun position and elevation raster map.r.sunmask.position - Calculates cast shadow areas from sun position and elevation raster map.r.in.lidar.info - Extract information from LAS filer.in.lidar.info - Extract information from LAS filePerforms bilinear or bicubic spline interpolation with Tykhonov regularization.Performs bilinear or bicubic spline interpolation with Tykhonov regularization.Outputs raster map layer values lying along user defined transect line(s).Outputs raster map layer values lying along user defined transect line(s).Calculates solar elevation, solar azimuth, and sun hours.Calculates solar elevation, solar azimuth, and sun hours.Calculates patch number index on a raster map, using a 4 neighbour algorithm.Calculates patch number index on a raster map, using a 4 neighbour algorithm.r.li.renyi.ascii - Calculates Renyi's diversity index on a raster mapr.li.renyi.ascii - Calculates Renyi's diversity index on a raster mapr.blend.combine - Blends color components of two raster maps by a given ratio and export into a unique raster.r.blend.combine - Blends color components of two raster maps by a given ratio and export into a unique raster.Performs contextual image classification using sequential maximum a posteriori (SMAP) estimation.Performs contextual image classification using sequential maximum a posteriori (SMAP) estimation.Generates spectral signatures for land cover types in an image using a clustering algorithm.Generates spectral signatures for land cover types in an image using a clustering algorithm.i.eb.hsebal01.coords - Computes sensible heat flux iteration SEBAL 01. Inline coordinatesi.eb.hsebal01.coords - Computes sensible heat flux iteration SEBAL 01. Inline coordinatesComputes biomass growth, precursor of crop yield calculation.Computes biomass growth, precursor of crop yield calculation.Calculates Optimum-Index-Factor table for spectral bandsCalculates Optimum-Index-Factor table for spectral bandsRaster map calculator.Raster map calculator.Calculates shape index on a raster mapCalculates shape index on a raster mapCalculates Pielou's diversity index on a raster mapCalculates Pielou's diversity index on a raster mapComputes potential evapotranspiration calculation with hourly Penman-Monteith.Computes potential evapotranspiration calculation with hourly Penman-Monteith.r.li.shape.ascii - Calculates shape index on a raster mapr.li.shape.ascii - Calculates shape index on a raster mapIdentifies segments (objects) from imagery data.Identifies segments (objects) from imagery data.Computes topographic correction of reflectance.Computes topographic correction of reflectance.Computes evapotranspiration calculation Priestley and Taylor formulation, 1972.Computes evapotranspiration calculation Priestley and Taylor formulation, 1972.Calculates different types of vegetation indices.Calculates different types of vegetation indices.Generates statistics for i.smap from raster map.Generates statistics for i.smap from raster map.Computes evaporative fraction (Bastiaanssen, 1995) and root zone soil moisture (Makin, Molden and Bastiaanssen, 2001).Computes evaporative fraction (Bastiaanssen, 1995) and root zone soil moisture (Makin, Molden and Bastiaanssen, 2001).Actual evapotranspiration for diurnal period (Bastiaanssen, 1995). Actual evapotranspiration for diurnal period (Bastiaanssen, 1995). r.mask.rast - Creates a MASK for limiting raster operation.r.mask.rast - Creates a MASK for limiting raster operation.i.topo.coor.ill - Creates illumination model for topographic correction of reflectance.i.topo.coor.ill - Creates illumination model for topographic correction of reflectance.Calculates dominance's diversity index on a raster mapCalculates dominance's diversity index on a raster mapr.walk.points - Creates a raster map showing the anisotropic cumulative cost of moving between different geographic locations on an input raster map whose cell category values represent cost from point vector layers.r.walk.points - Creates a raster map showing the anisotropic cumulative cost of moving between different geographic locations on an input raster map whose cell category values represent cost from point vector layers.Computes broad band albedo from surface reflectance. Computes broad band albedo from surface reflectance. Imports SPOT VGT NDVI data into a raster map.Imports SPOT VGT NDVI data into a raster map.Performs Landsat TM/ETM+ Automatic Cloud Cover Assessment (ACCA).Performs Landsat TM/ETM+ Automatic Cloud Cover Assessment (ACCA).Performs auto-balancing of colors for RGB images.Performs auto-balancing of colors for RGB images.Computes evapotranspiration calculation modified or original Hargreaves formulation, 2001.Computes evapotranspiration calculation modified or original Hargreaves formulation, 2001.Principal components analysis (PCA) for image processing.Principal components analysis (PCA) for image processing.Calculates top-of-atmosphere radiance or reflectance and temperature for Landsat MSS/TM/ETM+/OLICalculates top-of-atmosphere radiance or reflectance and temperature for Landsat MSS/TM/ETM+/OLIClassifies the cell spectral reflectances in imagery data.Classifies the cell spectral reflectances in imagery data.Performs Tasseled Cap (Kauth Thomas) transformation.Performs Tasseled Cap (Kauth Thomas) transformation.Computes temporal integration of satellite ET actual (ETa) following the daily ET reference (ETo) from meteorological station(s).Computes temporal integration of satellite ET actual (ETa) following the daily ET reference (ETo) from meteorological station(s).Net radiation approximation (Bastiaanssen, 1995).Net radiation approximation (Bastiaanssen, 1995).r.li.pielou.ascii - Calculates Pielou's diversity index on a raster mapr.li.pielou.ascii - Calculates Pielou's diversity index on a raster mapRegroup multiple mono-band rasters into a single multiband raster.Regroup multiple mono-band rasters into a single multiband raster.Rapidly fills 'no data' cells (NULLs) of a raster map with interpolated values (IDW).Rapidly fills 'no data' cells (NULLs) of a raster map with interpolated values (IDW).Image fusion algorithms to sharpen multispectral with high-res panchromatic channelsImage fusion algorithms to sharpen multispectral with high-res panchromatic channelsSoil heat flux approximation (Bastiaanssen, 1995).Soil heat flux approximation (Bastiaanssen, 1995).Mosaics several images and extends colormap.Mosaics several images and extends colormap.Calculates Top of Atmosphere Radiance/Reflectance/Brightness Temperature from ASTER DN.Calculates Top of Atmosphere Radiance/Reflectance/Brightness Temperature from ASTER DN.r.li.simpson.ascii - Calculates Simpson's diversity index on a raster mapr.li.simpson.ascii - Calculates Simpson's diversity index on a raster mapr.stats.quantile.out - Compute category quantiles using two passes and output statisticsr.stats.quantile.out - Compute category quantiles using two passes and output statisticsCalculates mean pixel attribute index on a raster mapCalculates mean pixel attribute index on a raster mapCalculates multiple linear regression from raster maps.Calculates multiple linear regression from raster maps.r.topmodel.topidxstats - Builds a TOPMODEL topographic index statistics file.r.topmodel.topidxstats - Builds a TOPMODEL topographic index statistics file.r.category.out - Exports category values and labels associated with user-specified raster map layers.r.category.out - Exports category values and labels associated with user-specified raster map layers.Calculates Shannon's diversity index on a raster mapCalculates Shannon's diversity index on a raster mapFinds shortest path using timetables.Finds shortest path using timetables.Converts a raster map layer into a height-field file for POV-RayConverts a raster map layer into a height-field file for POV-RayImports E00 file into a vector mapImports E00 file into a vector mapExports a vector map to a GRASS ASCII vector representation.Exports a vector map to a GRASS ASCII vector representation.Exports a vector map layer to PostGIS feature table. Exports a vector map layer to PostGIS feature table. Converts raster maps into the VTK-ASCII formatConverts raster maps into the VTK-ASCII formatA simple utility for converting bearing and distance measurements to coordinates and vice versa. It assumes a Cartesian coordinate systemA simple utility for converting bearing and distance measurements to coordinates and vice versa. It assumes a Cartesian coordinate systemExports a GRASS raster to a binary MAT-FileExports a GRASS raster to a binary MAT-FileSplit lines to shorter segments by length.Split lines to shorter segments by length.r.li.edgedensity.ascii - Calculates edge density index on a raster map, using a 4 neighbour algorithmr.li.edgedensity.ascii - Calculates edge density index on a raster map, using a 4 neighbour algorithmConverts (rasterize) a vector layer into a raster layer.Converts (rasterize) a vector layer into a raster layer.Computes bridges and articulation points in the network.Computes bridges and articulation points in the network.Export a raster layer into a GRASS ASCII text fileExport a raster layer into a GRASS ASCII text fileExports a raster map to a text file as x,y,z values based on cell centersExports a raster map to a text file as x,y,z values based on cell centersSelects vector objects from a vector layer and creates a new layer containing only the selected objects.Selects vector objects from a vector layer and creates a new layer containing only the selected objects.Converts 3 GRASS raster layers (R,G,B) to a PPM image fileConverts 3 GRASS raster layers (R,G,B) to a PPM image fileUploads raster values at positions of vector centroids to the table.Uploads raster values at positions of vector centroids to the table.Creates a vector map from an ASCII points file or ASCII vector file.Creates a vector map from an ASCII points file or ASCII vector file.Creates a buffer around vector features of given type. Creates a buffer around vector features of given type. Performs network maintenancePerforms network maintenanceCalculates category or object oriented statistics (accumulator-based statistics)Calculates category or object oriented statistics (accumulator-based statistics)Reclassifies a raster layer, selecting areas lower than a user specified sizeReclassifies a raster layer, selecting areas lower than a user specified sizeExport a GRASS raster map as a non-georeferenced PNG imageExport a GRASS raster map as a non-georeferenced PNG imageConverts 2D vector features to 3D by sampling of elevation raster map.Converts 2D vector features to 3D by sampling of elevation raster map.r.walk.coords - Creates a raster map showing the anisotropic cumulative cost of moving between different geographic locations on an input raster map whose cell category values represent cost from a list of coordinates.r.walk.coords - Creates a raster map showing the anisotropic cumulative cost of moving between different geographic locations on an input raster map whose cell category values represent cost from a list of coordinates.Fills lake at given point to given level.Fills lake at given point to given level.Re-projects a vector map from one location to the current locationRe-projects a vector map from one location to the current locationPerforms surface interpolation from vector points map by splines.Performs surface interpolation from vector points map by splines.Converts raster map series to MPEG movieConverts raster map series to MPEG moviePerforms cluster identificationPerforms cluster identificationProduces a vector map of specified contours from a raster map. Produces a vector map of specified contours from a raster map. Exports a vector map to SVG file.Exports a vector map to SVG file.Decimates a point cloudDecimates a point cloudr.li.shannon.ascii - Calculates Shannon's diversity index on a raster mapr.li.shannon.ascii - Calculates Shannon's diversity index on a raster mapCalculates patch density index on a raster map, using a 4 neighbour algorithmCalculates patch density index on a raster map, using a 4 neighbour algorithmCalculates mean patch size index on a raster map, using a 4 neighbour algorithmCalculates mean patch size index on a raster map, using a 4 neighbour algorithmCalculates standard deviation of patch area a raster mapCalculates standard deviation of patch area a raster mapr.what.coords - Queries raster maps on their category values and category labels on a point.r.what.coords - Queries raster maps on their category values and category labels on a point.Calculates edge density index on a raster map, using a 4 neighbour algorithmCalculates edge density index on a raster map, using a 4 neighbour algorithmCreates/modifies the color table associated with a raster map.Creates/modifies the color table associated with a raster map.r.li.padcv.ascii - Calculates coefficient of variation of patch area on a raster mapr.li.padcv.ascii - Calculates coefficient of variation of patch area on a raster mapSplits a raster map into tilesSplits a raster map into tilesCreates a fractal surface of a given fractal dimension.Creates a fractal surface of a given fractal dimension.r.li.mps.ascii - Calculates mean patch size index on a raster map, using a 4 neighbour algorithmr.li.mps.ascii - Calculates mean patch size index on a raster map, using a 4 neighbour algorithmGenerates random surface(s) with spatial dependence.Generates random surface(s) with spatial dependence.r.what.points - Queries raster maps on their category values and category labels on a layer of points.r.what.points - Queries raster maps on their category values and category labels on a layer of points.Creates a raster map layer showing buffer zones surrounding cells that contain non-NULL category values (low-memory alternative).Creates a raster map layer showing buffer zones surrounding cells that contain non-NULL category values (low-memory alternative).Calculates contrast weighted edge density index on a raster mapCalculates contrast weighted edge density index on a raster mapManages category values and labels associated with user-specified raster map layers.Manages category values and labels associated with user-specified raster map layers.Calculates range of patch area size on a raster mapCalculates range of patch area size on a raster mapCalculates richness index on a raster mapCalculates richness index on a raster mapr.stats.quantile.rast - Compute category quantiles using two passes and output rasters.r.stats.quantile.rast - Compute category quantiles using two passes and output rasters.r.blend.rgb - Blends color components of two raster maps by a given ratio and exports into three rasters.r.blend.rgb - Blends color components of two raster maps by a given ratio and exports into three rasters.Calculates coefficient of variation of patch area on a raster mapCalculates coefficient of variation of patch area on a raster mapGenerates rate of spread raster maps.Generates rate of spread raster maps.Calculates Simpson's diversity index on a raster mapCalculates Simpson's diversity index on a raster mapMakes each output cell value an accumulation function of the values assigned to the corresponding cells in the input raster map layers.Makes each output cell value an accumulation function of the values assigned to the corresponding cells in the input raster map layers.Computes USLE R factor, Rainfall erosivity index.Computes USLE R factor, Rainfall erosivity index.Interpolates raster maps located (temporal or spatial) in between input raster maps at specific sampling positions.Interpolates raster maps located (temporal or spatial) in between input raster maps at specific sampling positions.Imagery (i.*)Imagery (i.*)r.li.cwed.ascii - Calculates contrast weighted edge density index on a raster mapr.li.cwed.ascii - Calculates contrast weighted edge density index on a raster mapr.mask.vect - Creates a MASK for limiting raster operation with a vector layer.r.mask.vect - Creates a MASK for limiting raster operation with a vector layer.Creates topographic index layer from elevation raster layerCreates topographic index layer from elevation raster layerCalculates Renyi's diversity index on a raster mapCalculates Renyi's diversity index on a raster mapResamples raster map layers using an analytic kernel.Resamples raster map layers using an analytic kernel.Exports the color table associated with a raster map.Exports the color table associated with a raster map.Queries colors for a raster map layer. Queries colors for a raster map layer. Splits a raster map into red, green and blue maps.Splits a raster map into red, green and blue maps.Computes USLE Soil Erodibility Factor (K).Computes USLE Soil Erodibility Factor (K).r.li.dominance.ascii - Calculates dominance's diversity index on a raster mapr.li.dominance.ascii - Calculates dominance's diversity index on a raster mapLocates the closest points between objects in two raster maps.Locates the closest points between objects in two raster maps.r.li.padsd.ascii - Calculates standard deviation of patch area a raster mapr.li.padsd.ascii - Calculates standard deviation of patch area a raster mapr.walk.rast - Creates a raster map showing the anisotropic cumulative cost of moving between different geographic locations on an input raster map whose cell category values represent cost from a raster.r.walk.rast - Creates a raster map showing the anisotropic cumulative cost of moving between different geographic locations on an input raster map whose cell category values represent cost from a raster.r.li.patchnum.ascii - Calculates patch number index on a raster map, using a 4 neighbour algorithm.r.li.patchnum.ascii - Calculates patch number index on a raster map, using a 4 neighbour algorithm.r.li.patchdensity.ascii - Calculates patch density index on a raster map, using a 4 neighbour algorithmr.li.patchdensity.ascii - Calculates patch density index on a raster map, using a 4 neighbour algorithmNumerical calculation program for transient, confined and unconfined solute transport in two dimensionsNumerical calculation program for transient, confined and unconfined solute transport in two dimensionsCreates a latitude/longitude raster map.Creates a latitude/longitude raster map.Simulates TOPMODEL which is a physically based hydrologic model.Simulates TOPMODEL which is a physically based hydrologic model.Simulates elliptically anisotropic spread.Simulates elliptically anisotropic spread.Drapes a color raster over an shaded relief or aspect map. Drapes a color raster over an shaded relief or aspect map. Exports GRASS vector map layers to DXF file format.Exports GRASS vector map layers to DXF file format.Generates a raster layer with contiguous areas grown by one cell.Generates a raster layer with contiguous areas grown by one cell.Converts a raster layer to a PPM image file at the pixel resolution of the currently defined region.Converts a raster layer to a PPM image file at the pixel resolution of the currently defined region.Generates random cell values with spatial dependence.Generates random cell values with spatial dependence.Stream network extractionStream network extractionMiscellaneous (m.*)Miscellaneous (m.*)Create a new vector map layer by combining other vector map layers.Create a new vector map layer by combining other vector map layers.Performs an affine transformation on a vector layer.Performs an affine transformation on a vector layer.Reinterpolates using regularized spline with tension and smoothing.Reinterpolates using regularized spline with tension and smoothing.Recursively traces the least cost path backwards to cells from which the cumulative cost was determined.Recursively traces the least cost path backwards to cells from which the cumulative cost was determined.Creates parallel line to input vector lines.Creates parallel line to input vector lines.Recodes categorical raster maps.Recodes categorical raster maps.Horizon angle computation from a digital elevation model.Horizon angle computation from a digital elevation model.Exports GRASS raster map to GRIDATB.FOR map file (TOPMODEL)Exports GRASS raster map to GRIDATB.FOR map file (TOPMODEL)Indices for quadrat counts of vector point lists.Indices for quadrat counts of vector point lists.Detects the object's edges from a LIDAR data set.Detects the object's edges from a LIDAR data set.Thins non-zero cells that denote linear features in a raster layer.Thins non-zero cells that denote linear features in a raster layer.Import GetFeature from WFSImport GetFeature from WFSProduces a raster layer of uniform random deviates whose range can be expressed by the user.Produces a raster layer of uniform random deviates whose range can be expressed by the user.Produces the quantization file for a floating-point map.Produces the quantization file for a floating-point map.Creates a GRASS vector layer of a user-defined grid.Creates a GRASS vector layer of a user-defined grid.Extracts terrain parameters from a DEM.Extracts terrain parameters from a DEM.Creates a composite raster layer by using one (or more) layer(s) to fill in areas of "no data" in another map layer.Creates a composite raster layer by using one (or more) layer(s) to fill in areas of "no data" in another map layer.Raster (r.*)Raster (r.*)Transforms raster maps from RGB (Red-Green-Blue) color space to HIS (Hue-Intensity-Saturation) color space.Transforms raster maps from RGB (Red-Green-Blue) color space to HIS (Hue-Intensity-Saturation) color space.Correction of the v.lidar.growing output. It is the last of the three algorithms for LIDAR filtering.Correction of the v.lidar.growing output. It is the last of the three algorithms for LIDAR filtering.Generates watershed subbasins raster map.Generates watershed subbasins raster map.Outputs a covariance/correlation matrix for user-specified raster layer(s).Outputs a covariance/correlation matrix for user-specified raster layer(s).Compute quantiles using two passes.Compute quantiles using two passes.Vector (v.*)Vector (v.*)Classifies attribute data, e.g. for thematic mapping.Classifies attribute data, e.g. for thematic mapping.Random location perturbations of GRASS vector pointsRandom location perturbations of GRASS vector pointsChanges vector category values for an existing vector map according to results of SQL queries or a value in attribute table column.Changes vector category values for an existing vector map according to results of SQL queries or a value in attribute table column.Reports statistics for raster layers.Reports statistics for raster layers.r.relief.scaling - Creates shaded relief from an elevation layer (DEM).r.relief.scaling - Creates shaded relief from an elevation layer (DEM).Randomly generate a 2D/3D vector points map.Randomly generate a 2D/3D vector points map.Resamples raster layers to a coarser grid using aggregation.Resamples raster layers to a coarser grid using aggregation.Calculates category or object oriented statistics.Calculates category or object oriented statistics.Create points along input linesCreate points along input linesComputes minimum spanning tree for the network.Computes minimum spanning tree for the network.Computes the shortest path between all pairs of nodes in the networkComputes the shortest path between all pairs of nodes in the networkComputes vertex connectivity between two sets of nodes in the network.Computes vertex connectivity between two sets of nodes in the network.Creates Steiner tree for the network and given terminalsCreates Steiner tree for the network and given terminalsv.net.report - Reports lines information of a networkv.net.report - Reports lines information of a networkPerforms visibility graph construction.Performs visibility graph construction.Calculate error matrix and kappa parameter for accuracy assessment of classification result.Calculate error matrix and kappa parameter for accuracy assessment of classification result.Flow computation for massive grids.Flow computation for massive grids.Computes emissivity from NDVI, generic method for sparse land. Computes emissivity from NDVI, generic method for sparse land. Calculates univariate statistics from the non-null cells of a raster map.Calculates univariate statistics from the non-null cells of a raster map.Surface interpolation from vector point data by Inverse Distance Squared Weighting.Surface interpolation from vector point data by Inverse Distance Squared Weighting.Construction of flowlines, flowpath lengths, and flowaccumulation (contributing areas) from a raster digital elevation model (DEM).Construction of flowlines, flowpath lengths, and flowaccumulation (contributing areas) from a raster digital elevation model (DEM).Generates raster layers of slope, aspect, curvatures and partial derivatives from a elevation raster layer.Generates raster layers of slope, aspect, curvatures and partial derivatives from a elevation raster layer.Tests for normality for points.Tests for normality for points.Calculates linear regression from two raster layers : y = a + b*x.Calculates linear regression from two raster layers : y = a + b*x.Finds the mode of values in a cover layer within areas assigned the same category value in a user-specified base layer.Finds the mode of values in a cover layer within areas assigned the same category value in a user-specified base layer.Reports geometry statistics for vectors.Reports geometry statistics for vectors.Bicubic or bilinear spline interpolation with Tykhonov regularization.Bicubic or bilinear spline interpolation with Tykhonov regularization.Watershed basin creation program.Watershed basin creation program.Resamples raster map to a finer grid using interpolation.Resamples raster map to a finer grid using interpolation.Generates red, green and blue raster layers combining hue, intensity and saturation (HIS) values from user-specified input raster layers.Generates red, green and blue raster layers combining hue, intensity and saturation (HIS) values from user-specified input raster layers.Produces tilings of the source projection for use in the destination region and projection.Produces tilings of the source projection for use in the destination region and projection.r.li.richness.ascii - Calculates richness index on a raster mapr.li.richness.ascii - Calculates richness index on a raster mapr.li.mpa.ascii - Calculates mean pixel attribute index on a raster mapr.li.mpa.ascii - Calculates mean pixel attribute index on a raster mapSets color rules based on stddev from a raster map's mean value.Sets color rules based on stddev from a raster map's mean value.Generate images with textural features from a raster map.Generate images with textural features from a raster map.r.li.padrange.ascii - Calculates range of patch area size on a raster mapr.li.padrange.ascii - Calculates range of patch area size on a raster mapCreates a Delaunay triangulation from an input vector map containing points or centroids.Creates a Delaunay triangulation from an input vector map containing points or centroids.Generates area statistics for raster layers.Generates area statistics for raster layers.Traces a flow through an elevation model on a raster map.Traces a flow through an elevation model on a raster map.Produces a convex hull for a given vector map.Produces a convex hull for a given vector map.Creates points/segments from input vector lines and positions.Creates points/segments from input vector lines and positions.Samples a raster layer at vector point locations.Samples a raster layer at vector point locations.Creates a new map layer whose category values are based upon a reclassification of the categories in an existing raster map layer.Creates a new map layer whose category values are based upon a reclassification of the categories in an existing raster map layer.Transforms raster maps from HIS (Hue-Intensity-Saturation) color space to RGB (Red-Green-Blue) color space.Transforms raster maps from HIS (Hue-Intensity-Saturation) color space to RGB (Red-Green-Blue) color space.Toolset for cleaning topology of vector map.Toolset for cleaning topology of vector map.Calculates univariate statistics for attribute. Variance and standard deviation is calculated only for points if specified.Calculates univariate statistics for attribute. Variance and standard deviation is calculated only for points if specified.Zero-crossing "edge detection" raster function for image processing.Zero-crossing "edge detection" raster function for image processing.Prints vector map attributesPrints vector map attributesPerforms raster map matrix filter.Performs raster map matrix filter.Prints terse list of category values found in a raster layer.Prints terse list of category values found in a raster layer.Overlays two vector maps.Overlays two vector maps.Builds polylines from lines or boundaries.Builds polylines from lines or boundaries.Imports geonames.org country files into a GRASS vector points map.Imports geonames.org country files into a GRASS vector points map.Converts vector polygons or points to lines.Converts vector polygons or points to lines.Converts LAS LiDAR point clouds to a GRASS vector map with libLAS.Converts LAS LiDAR point clouds to a GRASS vector map with libLAS.Import ASCII x,y[,z] coordinates as a series of lines.Import ASCII x,y[,z] coordinates as a series of lines.v.kernel.vector - Generates a vector density map from vector points on a vector network.v.kernel.vector - Generates a vector density map from vector points on a vector network.Rectifies a vector by computing a coordinate transformation for each object in the vector based on the control points.Rectifies a vector by computing a coordinate transformation for each object in the vector based on the control points.v.kernel.rast - Generates a raster density map from vector points map.v.kernel.rast - Generates a raster density map from vector points map.Change the type of geometry elements.Change the type of geometry elements.Imports Mapgen or Matlab-ASCII vector maps into GRASS.Imports Mapgen or Matlab-ASCII vector maps into GRASS.Exports a vector map as GRASS GIS specific archive file.Exports a vector map as GRASS GIS specific archive file.Removes outliers from vector point data.Removes outliers from vector point data.Edits a vector map, allows adding, deleting and modifying selected vector features.Edits a vector map, allows adding, deleting and modifying selected vector features.Converts a vector map to VTK ASCII output.Converts a vector map to VTK ASCII output.Extrudes flat vector object to 3D with defined height.Extrudes flat vector object to 3D with defined height.Performs transformation of 2D vector features to 3D.Performs transformation of 2D vector features to 3D.v.build.check - Checks for topological errors.v.build.check - Checks for topological errors.Creates a raster map from LAS LiDAR points using univariate statistics.Creates a raster map from LAS LiDAR points using univariate statistics.Calculates univariate statistics from a raster map based on vector polygons and uploads statistics to new attribute columns.Calculates univariate statistics from a raster map based on vector polygons and uploads statistics to new attribute columns.Count points in areas and calculate statistics.Count points in areas and calculate statistics.Uploads vector values at positions of vector points to the table.Uploads vector values at positions of vector points to the table.Surface area estimation for rasters.Surface area estimation for rasters.Combines red, green and blue raster maps into a single composite raster map.Combines red, green and blue raster maps into a single composite raster map.Converts a raster into a vector layer.Converts a raster into a vector layer.Creates a cross product of the category values from multiple raster map layers.Creates a cross product of the category values from multiple raster map layers.Fills no-data areas in raster maps using spline interpolation.Fills no-data areas in raster maps using spline interpolation.Visualization and animation tool for GRASS data.Visualization and animation tool for GRASS data.Canonical components analysis (CCA) program for image processing.Canonical components analysis (CCA) program for image processing.Extracts quality control parameters from MODIS QC layers.Extracts quality control parameters from MODIS QC layers.Generates statistics for i.maxlik from raster map.Generates statistics for i.maxlik from raster map.Computes the maximum flow between two sets of nodes in the network.Computes the maximum flow between two sets of nodes in the network.v.net.nreport - Reports nodes information of a networkv.net.nreport - Reports nodes information of a networkCreates raster plane layer given dip (inclination), aspect (azimuth) and one point.Creates raster plane layer given dip (inclination), aspect (azimuth) and one point.Splits network by cost isolines.Splits network by cost isolines.Output basic information about a raster layer.Output basic information about a raster layer.Dissolves boundaries between adjacent areas sharing a common category number or attribute.Dissolves boundaries between adjacent areas sharing a common category number or attribute.Allocates subnets for nearest centers (direction from center)Allocates subnets for nearest centers (direction from center)Computes shortest distance via the network between the given sets of features.Computes shortest distance via the network between the given sets of features.Finds the nearest element in vector map 'to' for elements in vector map 'from'.Finds the nearest element in vector map 'to' for elements in vector map 'from'.Computes strongly and weakly connected components in the network.Computes strongly and weakly connected components in the network.Computes degree, centrality, betweeness, closeness and eigenvector centrality measures in the network.Computes degree, centrality, betweeness, closeness and eigenvector centrality measures in the network.Creates a cycle connecting given nodes (Traveling salesman problem)Creates a cycle connecting given nodes (Traveling salesman problem)Finds shortest path on vector networkFinds shortest path on vector networkCreates a raster map layer showing buffer zones surrounding cells that contain non-NULL category values.Creates a raster map layer showing buffer zones surrounding cells that contain non-NULL category values.Filters and generates a depressionless elevation layer and a flow direction layer from a given elevation raster layer.Filters and generates a depressionless elevation layer and a flow direction layer from a given elevation raster layer.GRASS raster map layer data resampling capability using nearest neighbors.GRASS raster map layer data resampling capability using nearest neighbors.Creates shaded relief from an elevation layer (DEM).Creates shaded relief from an elevation layer (DEM).Rescales histogram equalized the range of category values in a raster layer.Rescales histogram equalized the range of category values in a raster layer.Manages NULL-values of given raster map.Manages NULL-values of given raster map.Makes each cell category value a function of the category values assigned to the cells around itMakes each cell category value a function of the category values assigned to the cells around itSediment transport and erosion/deposition simulation using path sampling method (SIMWE).Sediment transport and erosion/deposition simulation using path sampling method (SIMWE).Generates a raster layer of distance to features in input layer.Generates a raster layer of distance to features in input layer.Tabulates the mutual occurrence (coincidence) of categories for two raster map layers.Tabulates the mutual occurrence (coincidence) of categories for two raster map layers.Watershed basin analysis program.Watershed basin analysis program.Creates a raster layer of Gaussian deviates.Creates a raster layer of Gaussian deviates.Creates a raster layer and vector point map containing randomly located points.Creates a raster layer and vector point map containing randomly located points.Selects features from vector map (A) by features from other vector map (B).Selects features from vector map (A) by features from other vector map (B).Creates a raster map containing concentric rings around a given point.Creates a raster map containing concentric rings around a given point.Recategorizes data in a raster map by grouping cells that form physically discrete areas into unique categories.Recategorizes data in a raster map by grouping cells that form physically discrete areas into unique categories.Creates a Voronoi diagram from an input vector layer containing points.Creates a Voronoi diagram from an input vector layer containing points.Outputs the raster layer values lying on user-defined line(s).Outputs the raster layer values lying on user-defined line(s).Outputs basic information about a user-specified vector map.Outputs basic information about a user-specified vector map.Randomly partition points into test/train sets.Randomly partition points into test/train sets.Takes vector stream data, transforms it to raster and subtracts depth from the output DEM.Takes vector stream data, transforms it to raster and subtracts depth from the output DEM.Building contour determination and Region Growing algorithm for determining the building insideBuilding contour determination and Region Growing algorithm for determining the building insideOverland flow hydrologic simulation using path sampling method (SIMWE).Overland flow hydrologic simulation using path sampling method (SIMWE).Makes each output cell value a function of the values assigned to the corresponding cells in the input raster layers.Makes each output cell value a function of the values assigned to the corresponding cells in the input raster layers.Creates a raster layer of cumulative cost of moving across a raster layer whose cell values represent cost.Creates a raster layer of cumulative cost of moving across a raster layer whose cell values represent cost.Rescales the range of category values in a raster layer.Rescales the range of category values in a raster layer.Solar irradiance and irradiation model.Solar irradiance and irradiation model.Computes the viewshed of a point on an elevation raster map.Computes the viewshed of a point on an elevation raster map.Calculates the volume of data "clumps".Calculates the volume of data "clumps".Inverse Fast Fourier Transform (IFFT) for image processing.Inverse Fast Fourier Transform (IFFT) for image processing.Vector based generalization.Vector based generalization.Surface generation program from rasterized contours.Surface generation program from rasterized contours.Converts to POV-Ray format, GRASS x,y,z -> POV-Ray x,z,yConverts to POV-Ray format, GRASS x,y,z -> POV-Ray x,z,ySurface interpolation utility for raster layers.Surface interpolation utility for raster layers.Visualization(NVIZ)Visualization(NVIZ)Makes each cell value a function of attribute values and stores in an output raster map.Makes each cell value a function of attribute values and stores in an output raster map.Converts files in DXF format to GRASS vector map format.Converts files in DXF format to GRASS vector map format.Fast Fourier Transform (FFT) for image processing.Fast Fourier Transform (FFT) for image processing.Performs atmospheric correction using the 6S algorithm.Performs atmospheric correction using the 6S algorithm.Export a raster layer to the Virtual Reality Modeling Language (VRML)Export a raster layer to the Virtual Reality Modeling Language (VRML)Numerical calculation program for transient, confined and unconfined groundwater flow in two dimensions.Numerical calculation program for transient, confined and unconfined groundwater flow in two dimensions.GridCreate gridCreate gridgrid,lines,polygons,vector,create,fishnet,diamond,hexagongrid,lines,polygons,vector,create,fishnet,diamond,hexagonVector creationVector creationPointPointLineLineRectangle (polygon)Rectangle (polygon)Diamond (polygon)Diamond (polygon)Hexagon (polygon)Hexagon (polygon)Grid typeGrid typeGrid extentGrid extentHorizontal spacingHorizontal spacingVertical spacingVertical spacingHorizontal overlayHorizontal overlayVertical overlayVertical overlayGridGridInvalid grid spacing: {0}/{1}Invalid grid spacing: {0}/{1}Horizontal spacing is too large for the covered areaHorizontal spacing is too large for the covered areaInvalid overlay: {0}/{1}Invalid overlay: {0}/{1}Vertical spacing is too large for the covered areaVertical spacing is too large for the covered areaTo preserve symmetry, hspacing is fixed relative to vspacing
hspacing is fixed at: {0} and hoverlay is fixed at: {1}
hoverlay cannot be negative. Increase hoverlay.To preserve symmetry, hspacing is fixed relative to vspacing
hspacing is fixed at: {0} and hoverlay is fixed at: {1}
hoverlay cannot be negative. Increase hoverlay.GridAveragePoint layerPoint layerZ value from fieldZ value from fieldThe first radius of search ellipseThe first radius of search ellipseThe second radius of search ellipseThe second radius of search ellipseAngle of search ellipse rotation in degrees (counter clockwise)Angle of search ellipse rotation in degrees (counter clockwise)Minimum number of data points to useMinimum number of data points to useNODATA marker to fill empty pointsNODATA marker to fill empty pointsAdditional creation optionsAdditional creation optionsOutput data typeOutput data typeInterpolated (moving average)Interpolated (moving average)Grid (Moving average)Grid (Moving average)Raster analysisRaster analysisGridDataMetricsMinimumMinimumMaximumMaximumRangeRangeCountCountAverage distanceAverage distanceAverage distance between pointsAverage distance between pointsPoint layerPoint layerZ value from fieldZ value from fieldData metric to useData metric to useThe first radius of search ellipseThe first radius of search ellipseThe second radius of search ellipseThe second radius of search ellipseAngle of search ellipse rotation in degrees (counter clockwise)Angle of search ellipse rotation in degrees (counter clockwise)Minimum number of data points to useMinimum number of data points to useNODATA marker to fill empty pointsNODATA marker to fill empty pointsAdditional creation optionsAdditional creation optionsOutput data typeOutput data typeInterpolated (data metrics)Interpolated (data metrics)Grid (Data metrics)Grid (Data metrics)Raster analysisRaster analysisGridInverseDistancePoint layerPoint layerZ value from fieldZ value from fieldWeighting powerWeighting powerSmoothingSmoothingThe first radius of search ellipseThe first radius of search ellipseThe second radius of search ellipseThe second radius of search ellipseAngle of search ellipse rotation in degrees (counter clockwise)Angle of search ellipse rotation in degrees (counter clockwise)Maximum number of data points to useMaximum number of data points to useMinimum number of data points to useMinimum number of data points to useNODATA marker to fill empty pointsNODATA marker to fill empty pointsAdditional creation optionsAdditional creation optionsOutput data typeOutput data typeInterpolated (IDW)Interpolated (IDW)Grid (Inverse distance to a power)Grid (Inverse distance to a power)Raster analysisRaster analysisGridInverseDistanceNearestNeighborPoint layerPoint layerZ value from fieldZ value from fieldWeighting powerWeighting powerSmoothingSmoothingThe radius of the search circleThe radius of the search circleMaximum number of data points to useMaximum number of data points to useMinimum number of data points to useMinimum number of data points to useNODATA marker to fill empty pointsNODATA marker to fill empty pointsAdditional creation optionsAdditional creation optionsOutput data typeOutput data typeInterpolated (IDW with NN search)Interpolated (IDW with NN search)Grid (IDW with nearest neighbor searching)Grid (IDW with nearest neighbor searching)Raster analysisRaster analysisGridLinearPoint layerPoint layerZ value from fieldZ value from fieldSearch distance Search distance NODATA marker to fill empty pointsNODATA marker to fill empty pointsAdditional creation optionsAdditional creation optionsOutput data typeOutput data typeInterpolated (Linear)Interpolated (Linear)Grid (Linear)Grid (Linear)Raster analysisRaster analysisGridNearestNeighborPoint layerPoint layerZ value from fieldZ value from fieldThe first radius of search ellipseThe first radius of search ellipseThe second radius of search ellipseThe second radius of search ellipseAngle of search ellipse rotation in degrees (counter clockwise)Angle of search ellipse rotation in degrees (counter clockwise)NODATA marker to fill empty pointsNODATA marker to fill empty pointsAdditional creation optionsAdditional creation optionsOutput data typeOutput data typeInterpolated (Nearest neighbor)Interpolated (Nearest neighbor)Grid (Nearest neighbor)Grid (Nearest neighbor)Raster analysisRaster analysisHeatmapheatmap,kde,hotspotheatmap,kde,hotspotInterpolationInterpolationHeatmap (Kernel Density Estimation)Heatmap (Kernel Density Estimation)QuarticQuarticTriangularTriangularUniformUniformTriweightTriweightEpanechnikovEpanechnikovRawRawScaledScaledPoint layerPoint layerRadiusRadiusRadius from fieldRadius from fieldHeatmapPixelSizeWidgetWrapperResolution of each pixel in output raster, in layer unitsResolution of each pixel in output raster, in layer unitsHelpEditionDialogCannot open help file: {0}Cannot open help file: {0}ProcessingProcessing<h2>Algorithm description</h2>
<h2>Algorithm description</h2>
<h2>Input parameters</h2>
<h2>Input parameters</h2>
<h2>Outputs</h2>
<h2>Outputs</h2>
Algorithm descriptionAlgorithm descriptionShort descriptionShort descriptionInput parametersInput parametersOutputsOutputsAlgorithm created byAlgorithm created byAlgorithm help written byAlgorithm help written byAlgorithm versionAlgorithm versionDocumentation help URLDocumentation help URLHillshadeRaster terrain analysisRaster terrain analysisElevation layerElevation layerZ factorZ factorAzimuth (horizontal angle)Azimuth (horizontal angle)Vertical angleVertical angleHillshadeHillshadeHistoryDialogClearClearConfirmationConfirmationClear historyClear historySave As…Save As…Save historySave historyAre you sure you want to clear the history?Are you sure you want to clear the history?Save FileSave FileCreate Test…Create Test…Log files (*.log *.LOG)Log files (*.log *.LOG)HistoryDialogPythonConsoleDialogDialogReloadReloadSaveSaveHubDistanceLinesVector analysisVector analysisMetersMetersFeetFeetMilesMilesKilometersKilometersLayer unitsLayer unitsSource points layerSource points layerDestination hubs layerDestination hubs layerHub layer name attributeHub layer name attributeMeasurement unitMeasurement unitHub distanceHub distanceDistance to nearest hub (line to hub)Distance to nearest hub (line to hub)Same layer given for both hubs and spokesSame layer given for both hubs and spokesHubDistancePointsVector analysisVector analysisMetersMetersFeetFeetMilesMilesKilometersKilometersLayer unitsLayer unitsSource points layerSource points layerDestination hubs layerDestination hubs layerHub layer name attributeHub layer name attributeMeasurement unitMeasurement unitHub distanceHub distanceDistance to nearest hub (points)Distance to nearest hub (points)Same layer given for both hubs and spokesSame layer given for both hubs and spokesHypsometricCurvesRaster terrain analysisRaster terrain analysisDEM to analyzeDEM to analyzeBoundary layerBoundary layerStepStepUse % of area instead of absolute valueUse % of area instead of absolute valueHypsometric curvesHypsometric curvesFeature {0} does not intersect raster or entirely located in NODATA areaFeature {0} does not intersect raster or entirely located in NODATA areaFeature {0} is smaller than raster cell sizeFeature {0} is smaller than raster cell sizeAreaAreaElevationElevationIdwInterpolationInterpolationInterpolationInput layer(s)Input layer(s)Distance coefficient PDistance coefficient PNumber of columnsNumber of columnsNumber of rowsNumber of rowsExtentExtentInterpolatedInterpolatedIDW interpolationIDW interpolationYou need to specify at least one input layer.You need to specify at least one input layer.ImportIntoPostGISDatabaseDatabaseLayer to importLayer to importDatabase (connection name)Database (connection name)Schema (schema name)Schema (schema name)Table to import to (leave blank to use layer name)Table to import to (leave blank to use layer name)Primary key fieldPrimary key fieldGeometry columnGeometry columnEncodingEncodingOverwriteOverwriteCreate spatial indexCreate spatial indexConvert field names to lowercaseConvert field names to lowercaseDrop length constraints on character fieldsDrop length constraints on character fieldsCreate single-part geometries instead of multi-partCreate single-part geometries instead of multi-partExport to PostgreSQLExport to PostgreSQLExports a vector layer to a PostgreSQL databaseExports a vector layer to a PostgreSQL databaseimport,postgis,table,layer,into,copyimport,postgis,table,layer,into,copyError importing to PostGIS
{0}Error importing to PostGIS
{0}ImportIntoSpatialiteDatabaseDatabaseLayer to importLayer to importFile databaseFile databaseTable to import to (leave blank to use layer name)Table to import to (leave blank to use layer name)Primary key fieldPrimary key fieldGeometry columnGeometry columnEncodingEncodingOverwriteOverwriteCreate spatial indexCreate spatial indexConvert field names to lowercaseConvert field names to lowercaseDrop length constraints on character fieldsDrop length constraints on character fieldsCreate single-part geometries instead of multi-partCreate single-part geometries instead of multi-partExport to SpatiaLiteExport to SpatiaLiteExports a vector layer to a SpatiaLite databaseExports a vector layer to a SpatiaLite databaseimport,table,layer,into,copyimport,table,layer,into,copyError importing to Spatialite
{0}Error importing to Spatialite
{0}InPlaceAlgorithmLocatorFilterEdit Selected FeaturesEdit Selected FeaturesMissing dependencyMissing dependencyInfoViewerDB ManagerDB ManagerInterpolationDataWidgetPointsPointsStructure linesStructure linesBreak linesBreak linesKNearestConcaveHullConcave hull (k-nearest neighbor)Concave hull (k-nearest neighbor)Creates a concave hull using the k-nearest neighbor algorithm.Creates a concave hull using the k-nearest neighbor algorithm.Vector geometryVector geometryInput layerInput layerNumber of neighboring points to consider (a lower number is more concave, a higher number is smoother)Number of neighboring points to consider (a lower number is more concave, a higher number is smoother)Field (set if creating concave hulls by class)Field (set if creating concave hulls by class)Concave hullConcave hullKeepNBiggestPartsVector geometryVector geometryPolygonsPolygonsParts to keepParts to keepPartsPartsKeep N biggest partsKeep N biggest partsKonsole::TerminalDisplay<qt>Output has been <a href="http://en.wikipedia.org/wiki/Flow_control">suspended</a> by pressing Ctrl+S. Press <b>Ctrl+Q</b> to resume.</qt><qt>Output has been <a href="http://en.wikipedia.org/wiki/Flow_control">suspended</a> by pressing Ctrl+S. Press <b>Ctrl+Q</b> to resume.</qt>Konsole::Vt102EmulationNo keyboard translator available. The information needed to convert key presses into characters to send to the terminal is missing.No keyboard translator available. The information needed to convert key presses into characters to send to the terminal is missing.LayerPropertiesWidgetFormFormSymbol layer typeSymbol layer typeThis layer doesn't have any editable propertiesThis layer doesn't have any editable propertiesEnable layerEnable layer……Line3DSymbolWidgetFormFormHeightHeightExtrusionExtrusionAbsoluteAbsoluteRelativeRelativeTerrainTerrainAltitude clampingAltitude clampingAltitude bindingAltitude bindingVertexVertexCentroidCentroidWidthWidthRender as simple 3D linesRender as simple 3D linesLinesToPolygonsline,polygon,convertline,polygon,convertVector geometryVector geometryLines to polygonsLines to polygonsPolygonsPolygonsOne or more line ignored due to geometry not having a minimum of three vertices.One or more line ignored due to geometry not having a minimum of three vertices.MainWindow&Edit&Edit&View&ViewSelectSelectMeasureMeasureSave ToSave ToOpen FromOpen FromImport/ExportImport/Export&Decorations&Decorations&Layer&Layer&Plugins&Plugins&Help&Help&Settings&Settings&Raster&RasterVect&orVect&orCtrl+NCtrl+NCase sensitiveCase sensitiveWhole wordWhole wordReplaceReplaceFind what:Find what:Replace with:Replace with:FindFindProcessing Script EditorProcessing Script EditorToolbarToolbarOpen Script…Open Script…Open ScriptOpen ScriptSave Script…Save Script…Save ScriptSave ScriptSave Script as…Save Script as…Save Script asSave Script asRun ScriptRun ScriptIncrease Font SizeIncrease Font SizeDecrease Font SizeDecrease Font SizeFind && &ReplaceFind && &ReplaceCtrl+OCtrl+OCtrl+SCtrl+SCtrl+Shift+SCtrl+Shift+SCutCutCopyCopyPastePasteUndoUndoRedoRedoCtrl+PCtrl+PMenu ToolbarMenu ToolbarPreview ModePreview ModeCreate LayerCreate LayerAdd LayerAdd LayerStatusbarStatusbarManage Layers ToolbarManage Layers ToolbarDigitizing ToolbarDigitizing ToolbarAdvanced Digitizing ToolbarAdvanced Digitizing ToolbarMap Navigation ToolbarMap Navigation ToolbarAttributes ToolbarAttributes ToolbarPlugins ToolbarPlugins ToolbarHelp ToolbarHelp ToolbarRaster ToolbarRaster ToolbarLabel ToolbarLabel ToolbarVector ToolbarVector ToolbarDatabase ToolbarDatabase ToolbarWeb ToolbarWeb Toolbar&New&New&Save&SaveExit QGISExit QGISCtrl+QCtrl+Q&Undo&UndoCtrl+ZCtrl+Z&Redo&RedoCtrl+Shift+ZCtrl+Shift+ZCut FeaturesCut FeaturesCtrl+XCtrl+XCopy FeaturesCopy FeaturesCtrl+CCtrl+CPaste FeaturesPaste FeaturesCtrl+VCtrl+VAdd FeatureAdd FeatureCtrl+.Ctrl+.Move Feature(s)Move Feature(s)Reshape FeaturesReshape FeaturesSplit FeaturesSplit FeaturesSplit PartsSplit PartsDelete SelectedDelete SelectedAdd RingAdd RingAdd PartAdd PartSimplify FeatureSimplify FeatureDelete RingDelete RingDelete PartDelete PartMerge Selected FeaturesMerge Selected FeaturesMerge Attributes of Selected FeaturesMerge Attributes of Selected FeaturesRotate Point SymbolsRotate Point SymbolsOffset Point SymbolOffset Point SymbolReverse lineReverse line&Snapping Options…&Snapping Options…Pan MapPan MapZoom InZoom InZoom OutZoom OutSelect Features by PolygonSelect Features by PolygonSelect Features by FreehandSelect Features by FreehandSelect Features by RadiusSelect Features by RadiusDeselect Features from All LayersDeselect Features from All LayersSelect All FeaturesSelect All FeaturesCtrl+ACtrl+AInvert Feature SelectionInvert Feature SelectionIdentify FeaturesIdentify FeaturesCtrl+Shift+ICtrl+Shift+IMeasure LineMeasure LineCtrl+Shift+MCtrl+Shift+MMeasure AreaMeasure AreaCtrl+Shift+JCtrl+Shift+JMeasure AngleMeasure AngleCtrl+Shift+FCtrl+Shift+FCtrl+JCtrl+JZoom LastZoom LastZoom NextZoom NextShow information about a feature when the mouse is hovered over itShow information about a feature when the mouse is hovered over itNew Bookmark...New Bookmark...Ctrl+BCtrl+BShow BookmarksShow BookmarksCtrl+Shift+BCtrl+Shift+BRefreshRefreshText AnnotationText AnnotationForm AnnotationForm AnnotationMove AnnotationMove AnnotationLabelingLabelingLayer Labeling OptionsLayer Labeling OptionsNew Shapefile Layer...New Shapefile Layer...F6F6Save Layer AsSave Layer AsLayer PropertiesLayer PropertiesShow in OverviewShow in OverviewShow All in OverviewShow All in OverviewHide All from OverviewHide All from OverviewToggle Full Scr&een ModeToggle Full Scr&een ModeToggle Panel &VisibilityToggle Panel &VisibilityCtrl+TabCtrl+TabToggle Map OnlyToggle Map OnlyCtrl+Shift+TabCtrl+Shift+Tab&Properties…&Properties…Project PropertiesProject PropertiesCustom Projections...Custom Projections...Keyboard Shortcuts...Keyboard Shortcuts...Move Label and DiagramMove Label and DiagramRotate Label
Ctrl (Cmd) increments by 15 deg.Rotate Label
Ctrl (Cmd) increments by 15 deg.Interface Customization...Interface Customization...&Copyright Label…&Copyright Label…Copyright LabelCopyright Label&North Arrow…&North Arrow…North ArrowNorth Arrow&Scale Bar…&Scale Bar…Scale BarScale BarCopy StyleCopy StylePaste StylePaste Style&Grid…&Grid…Export Project to DXF…Export Project to DXF…Import Layers from DWG/DXF…Import Layers from DWG/DXF…&Add Circle by a Center Point and Another Point&Add Circle by a Center Point and Another Point&Add Rectangle from Extent&Add Rectangle from ExtentAdd &Rectangle from Center and a PointAdd &Rectangle from Center and a Point&Add Regular Polygon from Center and a Point&Add Regular Polygon from Center and a PointAdd &Regular Polygon from 2 PointsAdd &Regular Polygon from 2 PointsAdd Rectangle &from 3 PointsAdd Rectangle &from 3 PointsAdd Circle &from 2 Tangents and a PointAdd Circle &from 2 Tangents and a PointAdd Regular &Polygon from Center and a CornerAdd Regular &Polygon from Center and a CornerNew &Print Layout…New &Print Layout…New &Report…New &Report…CloseCloseRevert…Revert…Copy LayerCopy LayerPaste Layer/GroupPaste Layer/Group&Vertex Tool (Current Layer)&Vertex Tool (Current Layer)Vertex Tool (Current Layer)Vertex Tool (Current Layer)Select Features by Expression...Select Features by Expression...Ctrl+F3Ctrl+F3Temporary Scratch Layer...Temporary Scratch Layer...Hide Deselected LayersHide Deselected LayersCtrl+Shift+NCtrl+Shift+NSelect Features by ValueSelect Features by ValueCopy and Move Feature(s)Copy and Move Feature(s)&Layout Extents…&Layout Extents…Layout ExtentsLayout Extents&Data Source Manager&Data Source ManagerOpen Data Source ManagerOpen Data Source ManagerCtrl+LCtrl+LAdd Circle from &2 PointsAdd Circle from &2 PointsAdd circle from 2 pointsAdd circle from 2 pointsAdd Circle from &3 PointsAdd Circle from &3 PointsAdd circle from 3 pointsAdd circle from 3 pointsAdd Circle by a center point and another pointAdd Circle by a center point and another point&Add Ellipse from Center and 2 Points&Add Ellipse from Center and 2 PointsAdd Ellipse from center and 2 pointsAdd Ellipse from center and 2 pointsAdd Ellipse from &Center and a PointAdd Ellipse from &Center and a PointAdd Ellipse from center and a pointAdd Ellipse from center and a pointAdd Ellipse from &ExtentAdd Ellipse from &ExtentAdd Ellipse from extentAdd Ellipse from extentAdd Ellipse from &FociAdd Ellipse from &FociAdd Ellipse from fociAdd Ellipse from fociAdd rectangle from extentAdd rectangle from extentAdd rectangle from center and a pointAdd rectangle from center and a pointAdd regular polygon from center and a pointAdd regular polygon from center and a pointAdd regular polygon from 2 pointsAdd regular polygon from 2 pointsAdd &Circle from 3 TangentsAdd &Circle from 3 TangentsAdd circle from 3 tangentsAdd circle from 3 tangentsAdd rectangle from 3 pointsAdd rectangle from 3 pointsAdd circle from 2 tangents and a pointAdd circle from 2 tangents and a pointAdd regular polygon from center and a cornerAdd regular polygon from center and a cornerNew &3D Map ViewNew &3D Map ViewNew 3D Map ViewNew 3D Map ViewLayout Manager…Layout Manager…Show Layout ManagerShow Layout ManagerNew Print LayoutNew Print LayoutNew ReportNew ReportClose ProjectClose ProjectRevert Project to Saved versionRevert Project to Saved versionAdd Circular StringAdd Circular StringPaste Features AsPaste Features AsNew ProjectNew Project&Open…&Open…Open ProjectOpen ProjectSave ProjectSave ProjectSave &As…Save &As…Save Project AsSave Project AsExport Map to &Image…Export Map to &Image…Save Map as ImageSave Map as ImageExport Map to &PDF…Export Map to &PDF…Save Map as PDFSave Map as PDF&Vertex Tool (All Layers)&Vertex Tool (All Layers)Vertex Tool (All Layers)Vertex Tool (All Layers)Show Map TipsShow Map TipsAdd Circular String by RadiusAdd Circular String by RadiusDiagram OptionsDiagram OptionsLayer Diagram OptionsLayer Diagram OptionsNew GeoPackage Layer...New GeoPackage Layer...Modify Attributes of Selected FeaturesModify Attributes of Selected FeaturesModify the Attributes of all Selected Features SimultaneouslyModify the Attributes of all Selected Features SimultaneouslySelect Features by Value...Select Features by Value...F3F3Ctrl+Shift+ACtrl+Shift+ALayoutsLayoutsAdd CircleAdd CircleAdd EllipseAdd EllipseAdd RectangleAdd RectangleAdd Regular PolygonAdd Regular PolygonSnapping ToolbarSnapping ToolbarData Source Manager ToolbarData Source Manager ToolbarNew &Map ViewNew &Map ViewNew Map ViewNew Map ViewAdd Vector Layer...Add Vector Layer...Ctrl+Shift+VCtrl+Shift+VAdd Raster Layer...Add Raster Layer...Ctrl+Shift+RCtrl+Shift+RAdd PostGIS Layers...Add PostGIS Layers...Ctrl+Shift+DCtrl+Shift+DAdd SpatiaLite Layer...Add SpatiaLite Layer...Ctrl+Shift+LCtrl+Shift+LAdd MSSQL Spatial Layer...Add MSSQL Spatial Layer...Add Oracle Spatial Layer...Add Oracle Spatial Layer...Ctrl+Shift+OCtrl+Shift+OAdd WMS/WMTS Layer...Add WMS/WMTS Layer...Ctrl+Shift+WCtrl+Shift+WToggle EditingToggle EditingToggles the editing state of the current layerToggles the editing state of the current layerSave for Selected Layer(s)Save for Selected Layer(s)Save edits to current layer, but continue editingSave edits to current layer, but continue editingRemove Layer/GroupRemove Layer/GroupFilter...Filter...API DocumentationAPI DocumentationFull Histogram StretchFull Histogram StretchShow/Hide Labels And Diagrams
Click or marquee on feature to show label and diagram
Shift+click or marquee on label or diagram to hide it
Acts on currently active editable layerShow/Hide Labels And Diagrams
Click or marquee on feature to show label and diagram
Shift+click or marquee on label or diagram to hide it
Acts on currently active editable layerHTML AnnotationHTML AnnotationSVG AnnotationSVG AnnotationIncrease BrightnessIncrease BrightnessDecrease BrightnessDecrease BrightnessIncrease ContrastIncrease ContrastDecrease ContrastDecrease ContrastNeed Commercial Support?Need Commercial Support?Open Field Calculator...Open Field Calculator...New Vector Layer...New Vector Layer...Paste features in clipboard into a new temporary scratch layer.Paste features in clipboard into a new temporary scratch layer.Add from Layer Definition File...Add from Layer Definition File...Save As Layer Definition File...Save As Layer Definition File...NormalNormalNormal preview modeNormal preview modeSimulate Photocopy (Grayscale)Simulate Photocopy (Grayscale)Simulate photocopy (grayscale)Simulate photocopy (grayscale)Simulate Fax (Mono)Simulate Fax (Mono)Simulate fax (mono)Simulate fax (mono)Simulate Color Blindness (Protanope)Simulate Color Blindness (Protanope)Simulate color blindness (protanope)Simulate color blindness (protanope)Simulate Color Blindness (Deuteranope)Simulate Color Blindness (Deuteranope)Simulate color blindness (deuteranope)Simulate color blindness (deuteranope)Set Scale Visibility of Layer(s)Set Scale Visibility of Layer(s)Show Selected LayersShow Selected LayersHide Selected LayersHide Selected LayersStatistical SummaryStatistical SummaryShow statistical summaryShow statistical summaryAlign Rasters...Align Rasters...Add circular stringAdd circular stringAdd circular string by radiusAdd circular string by radiusReport an issueReport an issueCtrl+DCtrl+DNew SpatiaLite Layer...New SpatiaLite Layer...New from TemplateNew from TemplateShape Digitizing ToolbarShape Digitizing ToolbarRaster Calculator...Raster Calculator...Set CRS of Layer(s)Set CRS of Layer(s)Ctrl+Shift+CCtrl+Shift+CSet Project CRS from LayerSet Project CRS from LayerShow All LayersShow All LayersCtrl+Shift+UCtrl+Shift+UHide All LayersHide All LayersCtrl+Shift+HCtrl+Shift+HManage and Install Plugins...Manage and Install Plugins...Open Field CalculatorOpen Field CalculatorAdd Delimited Text Layer...Add Delimited Text Layer...Add Delimited Text LayerAdd Delimited Text LayerPaste features in clipboard into a new OGR vector layer.Paste features in clipboard into a new OGR vector layer.Project ToolbarProject ToolbarCtrl+Alt++Ctrl+Alt++Ctrl+Alt+-Ctrl+Alt+-Select Feature(s)Select Feature(s)Select Features by area or single clickSelect Features by area or single clickZoom to Native Resolution (100%)Zoom to Native Resolution (100%)F5F5Add DB2 Spatial Layer...Add DB2 Spatial Layer...Ctrl+Shift+2Ctrl+Shift+2Ctrl+FCtrl+FF11F11Ctrl+Shift+PCtrl+Shift+PLocal Histogram StretchLocal Histogram StretchStretch histogram of active raster to view extentsStretch histogram of active raster to view extentsHelp ContentsHelp ContentsF1F1QGIS Home PageQGIS Home PageCtrl+HCtrl+HCheck QGIS VersionCheck QGIS VersionCheck if your QGIS version is up to date (requires internet access)Check if your QGIS version is up to date (requires internet access)AboutAboutQGIS SponsorsQGIS SponsorsRotate LabelRotate LabelChange LabelChange LabelStyle Manager...Style Manager...Python ConsolePython ConsoleStretch Histogram to Full DatasetStretch Histogram to Full DatasetThis is here just to avoid shortcut conflicts, the shortcut is caught in QgsCustomizationThis is here just to avoid shortcut conflicts, the shortcut is caught in QgsCustomizationCtrl+MCtrl+MEmbed Layers and Groups...Embed Layers and Groups...Embed layers and groups from other project filesEmbed layers and groups from other project filesCreates a copyright label that is displayed on the map canvas.Creates a copyright label that is displayed on the map canvas."Creates a north arrow that is displayed on the map canvas""Creates a north arrow that is displayed on the map canvas"Creates a scale bar that is displayed on the map canvasCreates a scale bar that is displayed on the map canvasAdd WFS Layer...Add WFS Layer...Add WFS LayerAdd WFS LayerFeature ActionFeature ActionRun Feature ActionRun Feature ActionPan Map to SelectionPan Map to SelectionOffset CurveOffset CurveAdd WCS Layer...Add WCS Layer...GridGridPin/Unpin Labels and DiagramsPin/Unpin Labels and DiagramsPin/Unpin Labels and Diagrams
Click or marquee on label/diagram to pin
Shift unpins, Ctrl (Cmd) toggles state
Acts on all editable layersPin/Unpin Labels and Diagrams
Click or marquee on label/diagram to pin
Shift unpins, Ctrl (Cmd) toggles state
Acts on all editable layersHighlight Pinned Labels and DiagramsHighlight Pinned Labels and DiagramsNew Blank ProjectNew Blank ProjectLocal Cumulative Cut StretchLocal Cumulative Cut StretchLocal cumulative cut stretch using current extent, default limits and estimated values.Local cumulative cut stretch using current extent, default limits and estimated values.Full Dataset Cumulative Cut StretchFull Dataset Cumulative Cut StretchCumulative cut stretch using full dataset extent, default limits and estimated values.Cumulative cut stretch using full dataset extent, default limits and estimated values.Show/Hide Labels and DiagramsShow/Hide Labels and DiagramsDuplicate Layer(s)Duplicate Layer(s)Save for All LayersSave for All LayersRollback for All LayersRollback for All LayersCancel for All LayersCancel for All LayersRollback for Selected Layer(s)Rollback for Selected Layer(s)Current EditsCurrent EditsCancel for Selected Layer(s)Cancel for Selected Layer(s)Save Layer EditsSave Layer EditsRotate Feature(s)Rotate Feature(s)Select features using an expressionSelect features using an expressionAdd/Edit Virtual Layer...Add/Edit Virtual Layer...Add/Edit Virtual LayerAdd/Edit Virtual LayerFill RingFill RingAdd Arc&GIS MapServer Layer...Add Arc&GIS MapServer Layer...Add ArcGIS MapServer LayerAdd ArcGIS MapServer LayerAdd Ar&cGIS FeatureServer Layer...Add Ar&cGIS FeatureServer Layer...Add ArcGIS FeatureServer LayerAdd ArcGIS FeatureServer LayerOpen &RecentOpen &RecentPro&jectPro&jectZoom &FullZoom &FullZoom to &LayerZoom to &LayerZoom to &SelectionZoom to &SelectionOpen &Attribute TableOpen &Attribute Table&Save As...&Save As...&Properties...&Properties...&Options...&Options...Ctrl+Alt+PCtrl+Alt+PNew Temporary Scratch Layer...New Temporary Scratch Layer...New temporary scratch layerNew temporary scratch layerProcessing AlgorithmsProcessing AlgorithmsProcessing Algorithms ToolbarProcessing Algorithms ToolbarManageConnectionsDialogManage ConnectionsManage ConnectionsSave to fileSave to fileBrowseBrowseLoad from fileLoad from fileLoadLoadSaveSaveeXtensible Markup Language (*.xml *.XML)eXtensible Markup Language (*.xml *.XML)Load ConnectionsLoad ConnectionsSaved to {0}.Saved to {0}.File {0} exists. Overwrite?File {0} exists. Overwrite?Save ConnectionsSave ConnectionsLoading ConnectionsLoading ConnectionsMap3DConfigWidgetConfigure 3D Map RenderingConfigure 3D Map RenderingTerrainTerrainTile resolutionTile resolutionElevationElevationVertical scaleVertical scale px pxSkirt heightSkirt height map units map unitsMax. ground errorMax. ground errorMap tile resolutionMap tile resolutionMax. screen errorMax. screen errorZoom levelsZoom levels00Show labelsShow labelsShow map tile infoShow map tile infoShow bounding boxesShow bounding boxesShow camera's view centerShow camera's view centerMapLayerWidgetWrapperSelect fileSelect fileMatrixModelerWidgetClear?Clear?Are you sure you want to clear table?Are you sure you want to clear table?Enter column nameEnter column nameColumn nameColumn nameMeanAndStdDevPlotGraphicsGraphicsInput tableInput tableCategory name fieldCategory name fieldValue fieldValue fieldPlotPlotHTML files (*.html)HTML files (*.html)Mean and standard deviation plotMean and standard deviation plotMessageBarProgressExecuting algorithm <i>{0}</i>Executing algorithm <i>{0}</i>Problem executing algorithmProblem executing algorithmMetaSearchMetaSearch pluginMetaSearch pluginSearch Metadata CatalogsSearch Metadata CatalogsMetaSearch plugin helpMetaSearch plugin helpGet Help on MetaSearchGet Help on MetaSearchMetaSearchDialogMetaSearchMetaSearchSearchSearchFindFindSet globalSet globalMap extentMap extent-180-1809090-90-90180180 From FromKeywordsKeywordsXmaxXmaxYmaxYmaxXminXminYminYminResultsResultsView Search Results as XMLView Search Results as XML>>Service InfoService InfoGetCapabilities ResponseGetCapabilities ResponseNew…New…Edit…Edit…Delete…Delete…Save…Save…Add Default ServicesAdd Default ServicesLoad…Load…Connection NamingConnection NamingServer TimeoutServer TimeoutResults PagingResults Paging<<<<Add WCSAdd WCSAdd WMS/WMTSAdd WMS/WMTS<<Add WFSAdd WFSTypeTypeTitleTitleDouble-click to see full record informationDouble-click to see full record information>>>>Add DataAdd DataAdd ArcGIS MapServerAdd ArcGIS MapServerAdd ArcGIS FeatureServerAdd ArcGIS FeatureServerAdd GIS FileAdd GIS FileServicesServicesSettingsSettingsShowShowresults at a timeresults at a timeNo services/connections defined. To get started with MetaSearch, create a new connection by clicking 'New' or click 'Add default services'.No services/connections defined. To get started with MetaSearch, create a new connection by clicking 'New' or click 'Add default services'.Loading connectionsLoading connectionsSearch errorSearch errorConnection errorConnection errorSearch keywordsSearch keywordsNew Catalog ServiceNew Catalog ServiceEdit Catalog ServiceEdit Catalog ServiceRemove service {0}?Remove service {0}?Delete ServiceDelete Service{0} exists. Overwrite?{0} exists. Overwrite?Search error: {0}Search error: {0}Connection error: {0}Connection error: {0}0 results0 resultsShowing {0} - {1} of %n result(s)number of resultsShowing {0} - {1} of %n result(s)Showing {0} - {1} of %n result(s)Coordinate Transformation ErrorCoordinate Transformation ErrorEnd of results. Go to start?End of results. Go to start?NavigationNavigationStart of results. Go to end?Start of results. Go to end?Connection {0} exists. Overwrite?Connection {0} exists. Overwrite?Error getting response: {0}Error getting response: {0}Unable to locate record identifierUnable to locate record identifierError connecting to service: {0}Error connecting to service: {0}Value Error: {0}Value Error: {0}Unknown Error: {0}Unknown Error: {0}Saving serverSaving serverGetRecords errorGetRecords errorCSW Connection errorCSW Connection errorsecondssecondsRecord parsing errorRecord parsing errorWhen saving the connection of an OWS serviceWhen saving the connection of an OWS serviceUse the OWS Service Title and ask before overwritingUse the OWS Service Title and ask before overwritingUse the OWS Service Title and always overwrite if already availableUse the OWS Service Title and always overwrite if already availableUse a temporary name, which you can change laterUse a temporary name, which you can change laterMinimumBoundingGeometryVector geometryVector geometryEnvelope (Bounding Box)Envelope (Bounding Box)Minimum Oriented RectangleMinimum Oriented RectangleMinimum Enclosing CircleMinimum Enclosing CircleConvex HullConvex HullInput layerInput layerField (optional, set if features should be grouped by class)Field (optional, set if features should be grouped by class)Geometry typeGeometry typeBounding geometryBounding geometryMinimum bounding geometryMinimum bounding geometrybounding,box,bounds,envelope,minimum,oriented,rectangle,enclosing,circle,convex,hull,generalizationbounding,box,bounds,envelope,minimum,oriented,rectangle,enclosing,circle,convex,hull,generalizationModelerAlgorithmProviderModels folderModelerAlgorithmProviderModels folderModelsModelerAlgorithmProviderModelsCould not load model {0}ModelerAlgorithmProviderCould not load model {0}ProcessingProcessingCould not load model {0}
{1}ModelerAlgorithmProviderCould not load model {0}
{1}ModelerDialogSearch…Search…Enter model name hereEnter model name hereNameNameGroupGroupEnter group name hereEnter group name hereModel propertiesModel propertiesInputsInputsAlgorithmsAlgorithmsEnter algorithm name to filter listEnter algorithm name to filter listSave Model?Save Model?There are unsaved changes in this model. Do you want to keep those?There are unsaved changes in this model. Do you want to keep those?Model doesn't contain any algorithm and/or parameter and can't be executedModel doesn't contain any algorithm and/or parameter and can't be executedModel was saved inside current projectModel was saved inside current projectSave Model As ImageSave Model As ImagePNG files (*.png *.PNG)PNG files (*.png *.PNG)Save Model As PDFSave Model As PDFPDF files (*.pdf *.PDF)PDF files (*.pdf *.PDF)Save Model As SVGSave Model As SVGSVG files (*.svg *.SVG)SVG files (*.svg *.SVG)Save Model As Python ScriptSave Model As Python ScriptPlease a enter model name before savingPlease a enter model name before savingUnable to save edits. Reason:
{0}Unable to save edits. Reason:
{0}Model was correctly savedModel was correctly savedSave ModelSave ModelI/O errorI/O errorCan't save modelCan't save modelThe selected model could not be loaded.
See the log for more information.The selected model could not be loaded.
See the log for more information.Open ModelOpen ModelProcessing models (*.model3 *.MODEL3)Processing models (*.model3 *.MODEL3)Successfully exported model as image to <a href="{}">{}</a>Successfully exported model as image to <a href="{}">{}</a>Successfully exported model as PDF to <a href="{}">{}</a>Successfully exported model as PDF to <a href="{}">{}</a>Successfully exported model as SVG to <a href="{}">{}</a>Successfully exported model as SVG to <a href="{}">{}</a>Processing scripts (*.py *.PY)Processing scripts (*.py *.PY)Successfully exported model as python script to <a href="{}">{}</a>Successfully exported model as python script to <a href="{}">{}</a>Model was correctly saved to <a href="{}">{}</a>Model was correctly saved to <a href="{}">{}</a>Could not load model {0}Could not load model {0}ProcessingProcessingParametersParametersModelerNumberInputPanelExpression Based InputExpression Based InputModelerParameterDefinitionDialogParameter nameParameter nameCheckedCheckedParent layerParent layerAllowed data typeAllowed data typeAnyAnyNumberNumberStringStringDate/timeDate/timeAccept multiple fieldsAccept multiple fieldsDefault field name, or ; separated list of field names for multiple field parametersDefault field name, or ; separated list of field names for multiple field parametersGeometry typeGeometry typeGeometry Not RequiredGeometry Not RequiredPointPointLineLinePolygonPolygonAny Geometry TypeAny Geometry TypeData typeData typeRasterRasterDefault valueDefault value00TypeTypeFileFileParameter DefinitionParameter DefinitionAny Map LayerAny Map LayerVector (No Geometry Required)Vector (No Geometry Required)Vector (Point)Vector (Point)Vector (Line)Vector (Line)Vector (Polygon)Vector (Polygon)Vector (Any Geometry Type)Vector (Any Geometry Type)Min valueMin valueMax valueMax valueNoneNoneFolderFolderMandatoryMandatoryUnable to define parameterUnable to define parameterInvalid parameter nameInvalid parameter nameWrong or missing parameter valuesWrong or missing parameter valuesThe parameter `{}` is not registered, are you missing a required plugin?The parameter `{}` is not registered, are you missing a required plugin?MultilineTextPanel[Use text below][Use text below]MultipleFileInputDialogAll files (*.*)All files (*.*)Add fileAdd fileRemove file(s)Remove file(s)Remove allRemove allSelect File(s)Select File(s)MultipleInputDialogSelect AllSelect AllClear SelectionClear SelectionToggle SelectionToggle SelectionAdd File(s)…Add File(s)…All files (*.*)All files (*.*){0} files (*.{1}){0} files (*.{1})Select File(s)Select File(s)MultipleInputPanel0 elements selected0 elements selected{0} elements selected{0} elements selectedNearestNeighbourAnalysisVector analysisVector analysisInput layerInput layerNearest neighbourNearest neighbourHTML files (*.html)HTML files (*.html)Observed mean distanceObserved mean distanceExpected mean distanceExpected mean distanceNearest neighbour indexNearest neighbour indexNumber of pointsNumber of pointsZ-ScoreZ-ScoreNearest neighbour analysisNearest neighbour analysisNewConnectionDialogCreate a new Catalog connectionCreate a new Catalog connectionNameNameURLURLAuthenticationAuthenticationIf the service requires basic authentication, enter a user name and optional passwordIf the service requires basic authentication, enter a user name and optional passwordUser nameUser namePasswordPasswordSave ConnectionSave ConnectionBoth Name and URL must be provided.Both Name and URL must be provided.Name cannot contain '/'.Name cannot contain '/'.Overwrite {0}?Overwrite {0}?NewPreconfiguredAlgorithmActionCreate Preconfigured Algorithm…Create Preconfigured Algorithm…NumberInputPanelNot setNot setOffsetCurveInput layerInput layerGeometry column nameGeometry column nameOffset distance (left-sided: positive, right-sided: negative)Offset distance (left-sided: positive, right-sided: negative)Additional creation optionsAdditional creation optionsOffset curveOffset curveVector geoprocessingVector geoprocessingOgr2OgrTableToPostGisListDatabase (connection name)Database (connection name)Input layerInput layerShape encodingShape encodingSchema nameSchema nameTable name, leave blank to use input nameTable name, leave blank to use input namePrimary keyPrimary keyPrimary key (existing field, used if the above option is left empty)Primary key (existing field, used if the above option is left empty)Group N features per transaction (Default: 20000)Group N features per transaction (Default: 20000)Overwrite existing tableOverwrite existing tableAppend to existing tableAppend to existing tableAppend and add new fields to existing tableAppend and add new fields to existing tableDo not launder columns/table namesDo not launder columns/table namesContinue after a failure, skipping the failed recordContinue after a failure, skipping the failed recordKeep width and precision of input attributesKeep width and precision of input attributesAdditional creation optionsAdditional creation optionsImport layer/table as geometryless table into PostgreSQL databaseImport layer/table as geometryless table into PostgreSQL databaseVector miscellaneousVector miscellaneousSelect features using a SQL "WHERE" statement (Ex: column='value')Select features using a SQL "WHERE" statement (Ex: column='value')Ogr2OgrToPostGisListDatabase (connection name)Database (connection name)Input layerInput layerShape encodingShape encodingOutput geometry typeOutput geometry typeGeometry column nameGeometry column nameVector dimensionsVector dimensionsDistance tolerance for simplificationDistance tolerance for simplificationMaximum distance between 2 nodes (densification)Maximum distance between 2 nodes (densification)Select features by extent (defined in input layer CRS)Select features by extent (defined in input layer CRS)Clip the input layer using the above (rectangle) extentClip the input layer using the above (rectangle) extentGroup N features per transaction (Default: 20000)Group N features per transaction (Default: 20000)Overwrite existing tableOverwrite existing tableAppend to existing tableAppend to existing tableAppend and add new fields to existing tableAppend and add new fields to existing tableDo not launder columns/table namesDo not launder columns/table namesDo not create spatial indexDo not create spatial indexContinue after a failure, skipping the failed featureContinue after a failure, skipping the failed featureAdditional creation optionsAdditional creation optionsExport to PostgreSQL (available connections)Export to PostgreSQL (available connections)Exports a vector layer to an existing PostgreSQL database connectionExports a vector layer to an existing PostgreSQL database connectionimport,into,postgis,database,vectorimport,into,postgis,database,vectorVector miscellaneousVector miscellaneousAssign an output CRSAssign an output CRSReproject to this CRS on output Reproject to this CRS on output Override source CRSOverride source CRSSchema (schema name)Schema (schema name)Table to import to (leave blank to use layer name)Table to import to (leave blank to use layer name)Primary key (new field)Primary key (new field)Primary key (existing field, used if the above option is left empty)Primary key (existing field, used if the above option is left empty)Promote to MultipartPromote to MultipartKeep width and precision of input attributesKeep width and precision of input attributesSelect features using a SQL "WHERE" statement (Ex: column='value')Select features using a SQL "WHERE" statement (Ex: column='value')OgrToPostGisInput layerInput layerShape encodingShape encodingOutput geometry typeOutput geometry typeAssign an output CRSAssign an output CRSReproject to this CRS on output Reproject to this CRS on output Override source CRSOverride source CRSHostHostPortPortUsernameUsernameDatabase nameDatabase namePasswordPasswordSchema nameSchema nameTable name, leave blank to use input nameTable name, leave blank to use input namePrimary key (new field)Primary key (new field)Primary key (existing field, used if the above option is left empty)Primary key (existing field, used if the above option is left empty)Geometry column nameGeometry column nameVector dimensionsVector dimensionsDistance tolerance for simplificationDistance tolerance for simplificationMaximum distance between 2 nodes (densification)Maximum distance between 2 nodes (densification)Select features by extent (defined in input layer CRS)Select features by extent (defined in input layer CRS)Clip the input layer using the above (rectangle) extentClip the input layer using the above (rectangle) extentFields to include (leave empty to use all fields)Fields to include (leave empty to use all fields)Select features using a SQL "WHERE" statement (Ex: column='value')Select features using a SQL "WHERE" statement (Ex: column='value')Group N features per transaction (Default: 20000)Group N features per transaction (Default: 20000)Overwrite existing tableOverwrite existing tableAppend to existing tableAppend to existing tableAppend and add new fields to existing tableAppend and add new fields to existing tableDo not launder columns/table namesDo not launder columns/table namesDo not create spatial indexDo not create spatial indexContinue after a failure, skipping the failed featureContinue after a failure, skipping the failed featurePromote to MultipartPromote to MultipartKeep width and precision of input attributesKeep width and precision of input attributesAdditional creation optionsAdditional creation optionsExport to PostgreSQL (new connection)Export to PostgreSQL (new connection)Exports a vector layer to a new PostgreSQL database connectionExports a vector layer to a new PostgreSQL database connectionimport,into,postgis,database,vectorimport,into,postgis,database,vectorVector miscellaneousVector miscellaneousOneSideBufferRightRightLeftLeftInput layerInput layerGeometry column nameGeometry column nameBuffer distanceBuffer distanceBuffer sideBuffer sideDissolve by attributeDissolve by attributeDissolve all resultsDissolve all resultsProduce one feature for each geometry in any kind of geometry collection in the source fileProduce one feature for each geometry in any kind of geometry collection in the source fileAdditional creation optionsAdditional creation optionsOne-sided bufferOne-sided bufferOne side bufferOne side bufferVector geoprocessingVector geoprocessingOpenModelFromFileActionOpen Existing Model…Open Existing Model…ToolsToolsOpen ModelAddModelFromFileActionOpen ModelProcessing models (*.model3 *.MODEL3)AddModelFromFileActionProcessing models (*.model3 *.MODEL3)OpenScriptFromFileActionOpen Existing Script…Open Existing Script…ToolsToolsOpen ScriptAddScriptFromFileActionOpen ScriptProcessing scripts (*.py *.PY)AddScriptFromFileActionProcessing scripts (*.py *.PY)OracleDBPluginThere is no defined database connection "{0}".There is no defined database connection "{0}".OrderByDialogBaseDefine OrderDefine OrderExpressionExpressionAsc / DescAsc / DescNULLs handlingNULLs handlingOrthogonalizerectangle,perpendicular,right,angles,square,quadrilateraliserectangle,perpendicular,right,angles,square,quadrilateraliseVector geometryVector geometryMaximum angle tolerance (degrees)Maximum angle tolerance (degrees)Maximum algorithm iterationsMaximum algorithm iterationsOrthogonalizeOrthogonalizeOrthogonalizedOrthogonalizedError orthogonalizing geometryError orthogonalizing geometryPGDatabase&Table&TableRun &Vacuum AnalyzeRun &Vacuum AnalyzeRun &Refresh Materialized ViewRun &Refresh Materialized ViewSelect a table for vacuum analyze.Select a table for vacuum analyze.Select a materialized view for refresh.Select a materialized view for refresh.PGTableDo you want to {0} rule {1}?Do you want to {0} rule {1}?Table ruleTable ruleParameterAggregatesAggregatesAggregatesAggregatedAggregatedParser error in expression "{}": {}Parser error in expression "{}": {}Evaluation error in expression "{}": {}Evaluation error in expression "{}": {}ParameterHeatmapPixelSizeOutput raster sizeOutput raster sizeWeight from fieldWeight from fieldKernel shapeKernel shapeDecay ratio (Triangular kernels only)Decay ratio (Triangular kernels only)Output value scalingOutput value scalingHeatmapHeatmapCould not create destination layerCould not create destination layerError adding feature with ID {} to heatmapError adding feature with ID {} to heatmapCould not save destination layerCould not save destination layerParameterRasterCalculatorExpressionExpressionExpressionReference layer(s) (used for automated extent, cellsize, and CRS)Reference layer(s) (used for automated extent, cellsize, and CRS)Cell size (use 0 or empty to set it automatically)Cell size (use 0 or empty to set it automatically)Output extentOutput extentOutputOutputRaster calculatorRaster calculatorNo reference layer selected nor CRS providedNo reference layer selected nor CRS providedNo reference layer selected nor extent box providedNo reference layer selected nor extent box providedNo reference layer selected nor cellsize value providedNo reference layer selected nor cellsize value providedOutput '%1' from algorithm '%2'Output '%1' from algorithm '%2'Error parsing formulaError parsing formulaParameterVectorVrtDestinationVirtual vectorVirtual vectorVirtual stringVirtual stringBuild virtual vectorBuild virtual vectorInvalid datasource: {}Invalid datasource: {}ParameterVrtDestinationInput layersInput layersResolutionResolutionPlace each input file into a separate bandPlace each input file into a separate bandAllow projection differenceAllow projection differenceAdd alpha mask band to VRT when source raster has noneAdd alpha mask band to VRT when source raster has noneOverride projection for the output fileOverride projection for the output fileResampling algorithmResampling algorithmVirtualVirtualParametersPanel[Not selected][Not selected]Python identifier: ‘{}’Python identifier: ‘{}’Open output file after running algorithmOpen output file after running algorithmPhongMaterialWidgetFormFormDiffuseDiffuseAmbientAmbientSpecularSpecularShininessShininessPoint3DSymbolWidgetFormFormShapeShapeRadiusRadiusSizeSizeLengthLengthModelModel......Overwrite model materialOverwrite model materialMinor radiusMinor radiusTop radiusTop radiusBottom radiusBottom radiusAltitude clampingAltitude clampingAbsoluteAbsoluteRelativeRelativeTerrainTerrainXXYYZZTranslationTranslationScaleScaleRotationRotationPointDistanceVector analysisVector analysisLinear (N*k x 3) distance matrixLinear (N*k x 3) distance matrixStandard (N x T) distance matrixStandard (N x T) distance matrixSummary distance matrix (mean, std. dev., min, max)Summary distance matrix (mean, std. dev., min, max)Input point layerInput point layerInput unique ID fieldInput unique ID fieldTarget point layerTarget point layerTarget unique ID fieldTarget unique ID fieldOutput matrix typeOutput matrix typeUse only the nearest (k) target pointsUse only the nearest (k) target pointsDistance matrixDistance matrixPointsAlongGeometrycreate,interpolate,points,lines,regular,distance,bycreate,interpolate,points,lines,regular,distance,byVector geometryVector geometryInput layerInput layerDistanceDistanceStart offsetStart offsetEnd offsetEnd offsetPointsPointsPoints along geometryPoints along geometryPointsAlongLinesInput layerInput layerGeometry column nameGeometry column nameDistance from line start represented as fraction of line lengthDistance from line start represented as fraction of line lengthAdditional creation optionsAdditional creation optionsPoints along linesPoints along linesVector geoprocessingVector geoprocessingPointsDisplacementVector geometryVector geometryInput layerInput layerMinimum distance to other pointsMinimum distance to other pointsDisplacement distanceDisplacement distanceHorizontal distribution for two point caseHorizontal distribution for two point caseDisplacedDisplacedPoints displacementPoints displacementPointsFromLinesVector creationVector creationRaster layerRaster layerVector layerVector layerPoints along linesPoints along linesGenerate points (pixel centroids) along lineGenerate points (pixel centroids) along linePointsFromPolygonsVector creationVector creationRaster layerRaster layerVector layerVector layerPoints inside polygonsPoints inside polygonsGenerate points (pixel centroids) inside polygonsGenerate points (pixel centroids) inside polygonsPointsInPolygonVector analysisVector analysisPolygonsPolygonsPointsPointsWeight fieldWeight fieldClass fieldClass fieldCount field nameCount field nameCountCountCount points in polygonCount points in polygonPointsLayerFromTablepoints,create,values,attributespoints,create,values,attributesVector creationVector creationInput layerInput layerX fieldX fieldY fieldY fieldZ fieldZ fieldM fieldM fieldTarget CRSTarget CRSPoints from tablePoints from tableCreate points layer from tableCreate points layer from tablePointsToPathsInput point layerInput point layerGroup fieldGroup fieldOrder fieldOrder fieldVector creationVector creationjoin,points,lines,connectjoin,points,lines,connectDate format (if order field is DateTime)Date format (if order field is DateTime)PathsPathsDirectory for text outputDirectory for text outputPoints to pathPoints to pathPolarPlotGraphicsGraphicsInput layerInput layerCategory name fieldCategory name fieldValue fieldValue fieldPolar plotPolar plotHTML files (*.html)HTML files (*.html)PoleOfInaccessibilityfurthest,point,distant,extreme,maximum,centroid,center,centrefurthest,point,distant,extreme,maximum,centroid,center,centreVector geometryVector geometryInput layerInput layerToleranceTolerancePointPointPole of inaccessibilityPole of inaccessibilityError calculating pole of inaccessibilityError calculating pole of inaccessibilityPolygon3DSymbolWidgetFormFormNo cullingNo cullingFrontFrontBackBack......HeightHeightExtrusionExtrusionAbsoluteAbsoluteInvert normals (experimental)Invert normals (experimental)Altitude bindingAltitude bindingRelativeRelativeTerrainTerrainAltitude clampingAltitude clampingCulling modeCulling modeAdd back facesAdd back facesVertexVertexCentroidCentroidPolygonizecreate,lines,polygons,convertcreate,lines,polygons,convertVector geometryVector geometryProcessing lines…Processing lines…Noding lines…Noding lines…Polygonizing…Polygonizing…Saving polygons…Saving polygons…No polygons were created!No polygons were created!Input layerInput layerKeep table structure of line layerKeep table structure of line layerPolygons from linesPolygons from linesPolygonizePolygonizePolygonsToLinesline,polygon,convertline,polygon,convertVector geometryVector geometryPolygons to linesPolygons to linesLinesLinesPostGISThere is no defined database connection "{0}".There is no defined database connection "{0}".Action canceled by userAction canceled by userPostGISExecuteAndLoadSQLDatabaseDatabaseDatabase (connection name)Database (connection name)SQL querySQL queryUnique ID field nameUnique ID field nameGeometry field nameGeometry field nameOutput layerOutput layerPostgreSQL execute and load SQLPostgreSQL execute and load SQLExecutes a SQL command on a PostgreSQL database and loads the result as a tableExecutes a SQL command on a PostgreSQL database and loads the result as a tablepostgis,table,databasepostgis,table,databaseThis layer is invalid!
Please check the PostGIS log for error messages.This layer is invalid!
Please check the PostGIS log for error messages.PostGISExecuteSQLDatabaseDatabaseDatabase (connection name)Database (connection name)SQL querySQL queryPostgreSQL execute SQLPostgreSQL execute SQLExecutes a SQL command on a PostgreSQL databaseExecutes a SQL command on a PostgreSQL databasepostgis,databasepostgis,databaseError executing SQL:
{0}Error executing SQL:
{0}PostGisDBPluginThere is no defined database connection "{0}".There is no defined database connection "{0}".PostprocessingLoading resulting layersLoading resulting layersError loading result layer:Error loading result layer:The following layers were not correctly generated.The following layers were not correctly generated.You can check the 'Log Messages Panel' in QGIS main window to find more information about the execution of the algorithm.You can check the 'Log Messages Panel' in QGIS main window to find more information about the execution of the algorithm.PreconfiguredAlgorithmDialogOKOKUnable to execute algorithmUnable to execute algorithmMissing parameter value: {0}Missing parameter value: {0}Wrong or missing parameter valuesWrong or missing parameter valuesPreconfiguredAlgorithmProviderPreconfigured algorithmsPreconfiguredAlgorithmProviderPreconfigured algorithmsPrepareAPIDialogErrorErrorDoneDoneProcessingError: Algorithm {0} not found
Error: Algorithm {0} not found
ProcessingProcessingUnable to execute algorithm
{0}Unable to execute algorithm
{0}Warning: Not all input layers use the same CRS.
This can cause unexpected results.Warning: Not all input layers use the same CRS.
This can cause unexpected results.There were errors executing the algorithm.There were errors executing the algorithm.[Preconfigure][Preconfigure]Fields MapperFields MapperA mapping of field names to field type definitions and expressions. Used for the refactor fields algorithm.A mapping of field names to field type definitions and expressions. Used for the refactor fields algorithm.Error: Provider {0} could not be activated
Error: Provider {0} could not be activated
Results: {}Results: {}&Analysis Tools&Analysis Tools&Research Tools&Research Tools&Geoprocessing Tools&Geoprocessing ToolsG&eometry ToolsG&eometry Tools&Data Management Tools&Data Management ToolsMissing AlgorithmMissing AlgorithmThe algorithm "{}" is no longer available. (Perhaps a plugin was uninstalled?)The algorithm "{}" is no longer available. (Perhaps a plugin was uninstalled?)Missing DependencyMissing DependencyProjectionsProjectionsConversionConversionExtractionExtractionAnalysisAnalysisMiscellaneousMiscellaneousInvalid algorithm ID for menu: {}Invalid algorithm ID for menu: {}……<h3>Missing dependency. This algorithm cannot be run :-( </h3>
{0}<h3>Missing dependency. This algorithm cannot be run :-( </h3>
{0}A numeric parameter, including float or integer values.A numeric parameter, including float or integer values.A raster layer parameter.A raster layer parameter.A vector layer parameter, e.g. for algorithms which change layer styles, edit layers in place, or other operations which affect an entire layer.A vector layer parameter, e.g. for algorithms which change layer styles, edit layers in place, or other operations which affect an entire layer.Map LayerMap LayerAn expression parameter, to add custom expressions based on layer fields.An expression parameter, to add custom expressions based on layer fields.ExpressionExpressionAn enumerated type parameter.An enumerated type parameter.A file or folder parameter, for use with non-map layer file sources or folders.A file or folder parameter, for use with non-map layer file sources or folders.File/FolderFile/FolderVector FieldVector FieldA vector layer destination parameter.A vector layer destination parameter.A generic file based destination parameter.A generic file based destination parameter.A folder destination parameter.A folder destination parameter.A raster layer destination parameter.A raster layer destination parameter.Multiple InputMultiple InputA vector feature parameter, e.g. for algorithms which operate on the features within a layer.A vector feature parameter, e.g. for algorithms which operate on the features within a layer.Vector FeaturesVector FeaturesA feature sink destination parameter.A feature sink destination parameter.Feature SinkFeature SinkA freeform string parameter.A freeform string parameter.A boolean parameter, for true/false values.A boolean parameter, for true/false values.A vector field parameter, for selecting an existing field from a vector source.A vector field parameter, for selecting an existing field from a vector source.A map extent parameter.A map extent parameter.A geographic point parameter.A geographic point parameter.A coordinate reference system (CRS) input parameter.A coordinate reference system (CRS) input parameter.Raster LayerRaster LayerVector LayerVector LayerBooleanBooleanCRSCRSA numeric range parameter for processing algorithms.A numeric range parameter for processing algorithms.RangeRangePointPointEnumEnumExtentExtentA table (matrix) parameter for processing algorithms.A table (matrix) parameter for processing algorithms.MatrixMatrixVector DestinationVector DestinationFile DestinationFile DestinationFolder DestinationFolder DestinationRaster DestinationRaster DestinationStringStringAn input allowing selection of multiple sources, including multiple map layers or file sources.An input allowing selection of multiple sources, including multiple map layers or file sources.NumberNumberA numeric parameter representing a distance measure.A numeric parameter representing a distance measure.DistanceDistanceA raster band parameter, for selecting an existing band from a raster source.A raster band parameter, for selecting an existing band from a raster source.Raster BandRaster BandA generic map layer parameter, which accepts either vector or raster layers.A generic map layer parameter, which accepts either vector or raster layers.Could not load parameter %1 of type %2.Could not load parameter %1 of type %2.ProcessingConfigGeneralGeneralKeep dialog open after running an algorithmKeep dialog open after running an algorithmUse filename as layer nameUse filename as layer nameShow tooltip when there are disabled providersShow tooltip when there are disabled providersOutput folderOutput folderShow layer CRS definition in selection boxesShow layer CRS definition in selection boxesWarn before executing if parameter CRS's do not matchWarn before executing if parameter CRS's do not matchStyle for raster layersStyle for raster layersStyle for point layersStyle for point layersStyle for line layersStyle for line layersStyle for polygon layersStyle for polygon layersPre-execution scriptPre-execution scriptPost-execution scriptPost-execution scriptDo not filter (better performance)Do not filter (better performance)Ignore features with invalid geometriesIgnore features with invalid geometriesStop algorithm execution when a geometry is invalidStop algorithm execution when a geometry is invalidInvalid features filteringInvalid features filteringDefault output vector layer extensionDefault output vector layer extensionDefault output raster layer extensionDefault output raster layer extensionProcessingPlugin&Run Model…&Run Model…&Edit Model…&Edit Model…ProcessingProcessingPro&cessingPro&cessing&Toolbox&ToolboxGraphical &Modeler…Graphical &Modeler…&History…&History…&Results Viewer&Results ViewerEdit Features In-PlaceEdit Features In-PlaceOptionsOptionsProcessingToolboxProcessing ToolboxProcessing ToolboxEnter algorithm name to filter listEnter algorithm name to filter list<html><head/><body><p>You can add more algorithms to the toolbox, <a href="enable"><span style=" text-decoration: underline; color:#0000ff;">enable additional providers.</span></a> <a href="close"><span style=" text-decoration: underline; color:#0000ff;">[close]</span></a></p></body></html><html><head/><body><p>You can add more algorithms to the toolbox, <a href="enable"><span style=" text-decoration: underline; color:#0000ff;">enable additional providers.</span></a> <a href="close"><span style=" text-decoration: underline; color:#0000ff;">[close]</span></a></p></body></html>Search…Search…Execute…Execute…Execute as Batch Process…Execute as Batch Process…Edit Rendering Styles for Outputs…Edit Rendering Styles for Outputs…{} complete{} completeError executing algorithmError executing algorithm<h3>This algorithm cannot be run :-( </h3>
{0}<h3>This algorithm cannot be run :-( </h3>
{0}ProjectProviderProject modelsProjectProviderProject modelsModels embedded in the current projectProjectProviderModels embedded in the current projectCould not load model from projectProjectProviderCould not load model from projectProcessingProcessingPropertyAssistantBaseOutputOutputInputInputtotoSourceSourceValues fromValues fromFetch value range from layerFetch value range from layerApply transform curveApply transform curvePropertyColorAssistantColor when NULLColor when NULLColor rampColor rampPropertyGenericNumericAssistantOutput fromOutput fromOutput when NULLOutput when NULLExponentExponenttotoPropertySizeAssistantSize fromSize fromSize when NULLSize when NULLExponentExponenttotoScale methodScale methodPythonPython warningPython warningPython version:Python version:QGIS version:QGIS version:Couldn't load plugin '{0}'Couldn't load plugin '{0}'{0} due to an error when calling its classFactory() method{0} due to an error when calling its classFactory() method{0} due to an error when calling its initGui() method{0} due to an error when calling its initGui() methodError while unloading plugin {0}Error while unloading plugin {0}Couldn't load server plugin {0}Couldn't load server plugin {0}{0} due to an error when calling its serverClassFactory() method{0} due to an error when calling its serverClassFactory() methodPython errorPython errorAn error has occurred while executing Python code:An error has occurred while executing Python code:See message log (Python Error) for more details.See message log (Python Error) for more details.Stack traceStack traceView message logView message logPython Path:Python Path:PythonConsolePython ConsolePython ConsoleCompile APIsCompile APIsSavedSavedDoneDoneHide EditorHide EditorCheck SyntaxCheck SyntaxRun ScriptRun ScriptUndoUndoRedoRedoFind TextFind TextOpen in External EditorOpen in External EditorCutCutCopyCopyPastePasteCommentCommentUncommentUncommentHide/Show Object InspectorHide/Show Object InspectorSelect AllSelect AllOpen Script…Open Script…Save As…Save As…Object Inspector…Object Inspector…Options…Options…Help…Help…Enter text to find…Enter text to find…Saving prepared file…Saving prepared file…Error preparing file…Error preparing file…<b>"{0}"</b> was not found.<b>"{0}"</b> was not found.URL copied to clipboard.URL copied to clipboard.Connection error: Connection error: [Temporary file saved in {0}] [Temporary file saved in {0}]## Script error: {0}## Script error: {0}## Script executed successfully: {0}## Script executed successfully: {0}Cannot execute file {0}. Error: {1}
Cannot execute file {0}. Error: {1}
Hey, type something to run!Hey, type something to run!Python Console: Save filePython Console: Save fileScript was correctly saved.Script was correctly saved.Click on button to restore all tabs from last session.Click on button to restore all tabs from last session.Restore tabsRestore tabsCloseCloseList all tabsList all tabsNew EditorNew EditorClose TabClose TabClose AllClose AllClose OthersClose OthersSave AsSave AsThe file {0} could not be opened. Error: {1}
The file {0} could not be opened. Error: {1}
Untitled-{0}Untitled-{0}Python Console: Save FilePython Console: Save FileThe file <b>'{0}'</b> has been modified, save changes?The file <b>'{0}'</b> has been modified, save changes?Unable to restore the file:
{0}
Unable to restore the file:
{0}
Python Console
Use iface to access QGIS API interface or Type help(iface) for more info
Security warning: typing commands from an untrusted source can lead to data loss and/or leakPython Console
Use iface to access QGIS API interface or Type help(iface) for more info
Security warning: typing commands from an untrusted source can lead to data loss and/or leakHide/Show ToolbarHide/Show ToolbarDouble-click on item to executeDouble-click on item to executeShow EditorShow EditorClear ConsoleClear ConsoleRun CommandRun CommandEnter SelectedEnter SelectedObject InspectorObject InspectorSaveSaveFind NextFind NextFind PreviousFind PreviousCase SensitiveCase SensitiveWhole WordWhole WordWrap AroundWrap AroundOpen FileOpen FileThe file <b>{0}</b> could not be saved. Error: {1}The file <b>{0}</b> could not be saved. Error: {1}Save File AsSave File AsRun SelectedRun SelectedShare on CodepadShare on CodepadHistory saved successfully.History saved successfully.Session and file history cleared successfully.Session and file history cleared successfully.History cleared successfully.History cleared successfully.Command HistoryCommand HistoryShowShowClear FileClear FileClear SessionClear SessionPython Console - Command HistoryPython Console - Command HistoryAdd API pathAdd API pathRemove API pathRemove API pathThe file <b>"{0}"</b> has been deleted or is not accessibleThe file <b>"{0}"</b> has been deleted or is not accessibleThe file <b>"{0}"</b> is read only, please save to different file first.The file <b>"{0}"</b> is read only, please save to different file first.QCoreApplicationArraysArraysGeneralGeneralCountCountCount DistinctCount DistinctCount MissingCount MissingMinMinMaxMaxSumSumMeanMeanMedianMedianStdevStdevStdev SampleStdev SampleRangeRangeMinorityMinorityMajorityMajorityQ1Q1Q3Q3InterQuartileRangeInterQuartileRangeMin LengthMin LengthMax LengthMax LengthConcatenateConcatenateCollectCollectArray AggregateArray AggregateQCoreApplication.QCoreApplication.QCoreApplication.QCoreApplication.QCoreApplication.selfIdleIdleQCoreApplication.QCoreApplication.QCoreApplication.QCoreApplication.selfIdleIdleQCoreApplication.selfErrorErrorQOCISpatialDriverUnable to initializeQOCISpatialDriverUnable to initializeUnable to logonUnable to logonUnable to begin transactionUnable to begin transactionUnable to commit transactionUnable to commit transactionUnable to rollback transactionUnable to rollback transactionQOCISpatialResultUnable to bind column for batch executeUnable to bind column for batch executeUnable to execute batch statementUnable to execute batch statementUnable to goto nextUnable to goto nextUnable to alloc statementUnable to alloc statementUnable to prepare statementUnable to prepare statementUnable to get statement typeUnable to get statement typeUnable to bind valueUnable to bind valueUnable to execute statementUnable to execute statementQObjectQGIS starting in non-interactive mode not supported.
You are seeing this message most likely because you have no DISPLAY environment variable set.
QGIS starting in non-interactive mode not supported.
You are seeing this message most likely because you have no DISPLAY environment variable set.
Invalid globalsettingsfile path: %1Invalid globalsettingsfile path: %1Successfully loaded globalsettingsfile path: %1Successfully loaded globalsettingsfile path: %1Moved verticesMoved verticesNo active vector layerNo active vector layerTo select features, choose a vector layer in the legendTo select features, choose a vector layer in the legendCRS ExceptionCRS ExceptionSelection extends beyond layer's coordinate systemSelection extends beyond layer's coordinate systemPython is not enabled in QGIS.Python is not enabled in QGIS.PluginsPluginsPlugin "%1" is not compatible with this version of QGIS.
It will be disabled.Plugin "%1" is not compatible with this version of QGIS.
It will be disabled.Loaded %1 (package: %2)Loaded %1 (package: %2)Library name is %1
Library name is %1
Failed to load %1 (Reason: %2)Failed to load %1 (Reason: %2)Attempting to resolve the classFactory function
Attempting to resolve the classFactory function
Loaded %1 (Path: %2)Loaded %1 (Path: %2)Loading PluginsLoading PluginsThere was an error loading a plugin. The following diagnostic information may help the QGIS developers resolve the issue:
%1.There was an error loading a plugin. The following diagnostic information may help the QGIS developers resolve the issue:
%1.Unable to find the class factory for %1.Unable to find the class factory for %1.Plugin %1 did not return a valid type and cannot be loadedPlugin %1 did not return a valid type and cannot be loadedPlugin %1Plugin %1The plugin will be disabled because it crashed QGIS during last startup. Please report an issue and re-enable the plugin when the problem has been solved.The plugin will be disabled because it crashed QGIS during last startup. Please report an issue and re-enable the plugin when the problem has been solved.Error when reading metadata of plugin %1Error when reading metadata of plugin %1Could not open CRS database %1
Error(%2): %3Could not open CRS database %1
Error(%2): %3CRSCRSProject points (Cartesian)Project points (Cartesian)bearing,azimuth,distance,anglebearing,azimuth,distance,angleProjectedProjectedThis algorithm projects point geometries by a specified distance and bearing (azimuth), creating a new point layer with the projected points.
The distance is specified in layer units, and the bearing in degrees clockwise from North.This algorithm projects point geometries by a specified distance and bearing (azimuth), creating a new point layer with the projected points.
The distance is specified in layer units, and the bearing in degrees clockwise from North.Bearing (degrees from North)Bearing (degrees from North)Projection distanceProjection distanceGenerated CRSA CRS automatically generated from layer info get this prefix for descriptionGenerated CRSSaved user CRS [%1]Saved user CRS [%1]Imported from GDALImported from GDALCaught a coordinate system exception while trying to transform a point. Unable to calculate line length.Caught a coordinate system exception while trying to transform a point. Unable to calculate line length.Caught a coordinate system exception while trying to transform a point. Unable to calculate polygon area.Caught a coordinate system exception while trying to transform a point. Unable to calculate polygon area.Cannot convert '%1' to doubleCannot convert '%1' to doubleCannot convert '%1' to intCannot convert '%1' to intCannot convert '%1' to native intCannot convert '%1' to native intCannot convert '%1' to DateTimeCannot convert '%1' to DateTimeCannot convert '%1' to DateCannot convert '%1' to DateCannot convert '%1' to TimeCannot convert '%1' to TimeCannot convert '%1' to intervalCannot convert '%1' to intervalCannot convert '%1' to gradient rampCannot convert '%1' to gradient rampCannot convert '%1' to arrayCannot convert '%1' to arrayCannot convert '%1' to mapCannot convert '%1' to mapCannot convert '%1' to booleanCannot convert '%1' to booleanDomain max must be greater than domain minDomain max must be greater than domain minExponent must be greater than 0Exponent must be greater than 0Cannot find layer with name or ID '%1'Cannot find layer with name or ID '%1'No such aggregate '%1'No such aggregate '%1'Could not calculate aggregate for: %1Could not calculate aggregate for: %1Cannot use relation aggregate function in this contextCannot use relation aggregate function in this contextCannot find relation with id '%1'Cannot find relation with id '%1'Cannot use aggregate function in this contextCannot use aggregate function in this contextInvalid pair of array, length not identicalInvalid pair of array, length not identicalFunction replace requires 2 or 3 argumentsFunction replace requires 2 or 3 argumentsInvalid regular expression '%1': %2Invalid regular expression '%1': %2Function `raster_value` requires a valid raster layer.Function `raster_value` requires a valid raster layer.Function `raster_value` requires a valid raster band number.Function `raster_value` requires a valid raster band number.Function `raster_value` requires a valid point geometry.Function `raster_value` requires a valid point geometry.Function `is_selected` requires no more than two parameters. %1 given.Function `is_selected` requires no more than two parameters. %1 given.Function `num_selected` requires no more than one parameter. %1 given.Function `num_selected` requires no more than one parameter. %1 given.Invalid formatting parameter: '%1'. It must be empty, or 'suffix' or 'aligned'.Invalid formatting parameter: '%1'. It must be empty, or 'suffix' or 'aligned'.Invalid axis name: '%1'. It must be either 'x' or 'y'.Invalid axis name: '%1'. It must be either 'x' or 'y'.Point index is out of rangePoint index is out of rangeFunction make_point requires 2-4 argumentsFunction make_point requires 2-4 argumentsFunction make_polygon requires an argumentFunction make_polygon requires an argumentSegment must be greater than 2Segment must be greater than 2Number of edges/sides must be greater than 2Number of edges/sides must be greater than 2Option can be 0 (inscribed) or 1 (circumscribed)Option can be 0 (inscribed) or 1 (circumscribed)Index is out of rangeIndex is out of rangeFunction `wedge_buffer` requires a point value for the center.Function `wedge_buffer` requires a point value for the center.Function `tapered_buffer` requires a line geometry.Function `tapered_buffer` requires a line geometry.Function `buffer_by_m` requires a line geometry.Function `buffer_by_m` requires a line geometry.Function `azimuth` requires exactly two parameters. %1 given.Function `azimuth` requires exactly two parameters. %1 given.Function `azimuth` requires two points as arguments.Function `azimuth` requires two points as arguments.line_substring requires a curve geometry inputline_substring requires a curve geometry inputNumber of places must be positiveNumber of places must be positiveCannot convert '%1:%2:%3' to colorCannot convert '%1:%2:%3' to colorCannot convert '%1:%2:%3:%4' to colorCannot convert '%1:%2:%3:%4' to color"%1" is not a valid color ramp"%1" is not a valid color rampCannot convert '%1:%2:%3:%4:%5' to colorCannot convert '%1:%2:%3:%4:%5' to colorCannot convert '%1' to colorCannot convert '%1:%2:%3:%4:%5' to color {1'?}Unknown color component '%1'Unknown color component '%1'A minimum of two colors is required to create a rampA minimum of two colors is required to create a rampTransform error caught in transform() function: %1Transform error caught in transform() function: %1Invalid band number %1 for layer %2Invalid band number %1 for layer %2Invalid raster statistic: '%1'Invalid raster statistic: '%1'Exception: %1Exception: %1GEOSGEOSsegment %1 of ring %2 of polygon %3 intersects segment %4 of ring %5 of polygon %6 at %7segment %1 of ring %2 of polygon %3 intersects segment %4 of ring %5 of polygon %6 at %7ring %1 with less than four pointsring %1 with less than four pointsring %1 not closedring %1 not closedline %1 with less than two pointsline %1 with less than two pointsline %1 contains %n duplicate node(s) at %2number of duplicate nodesline %1 contains %n duplicate node(s) at %2line %1 contains %n duplicate node(s) at %2segments %1 and %2 of line %3 intersect at %4segments %1 and %2 of line %3 intersect at %4Ring %1 of polygon %2 not in exterior ringRing %1 of polygon %2 not in exterior ringTopology validation errorGEOS ErrorTopology validation errorRepeated pointGEOS ErrorRepeated pointHole lies outside shellGEOS ErrorHole lies outside shellHoles are nestedGEOS ErrorHoles are nestedInterior is disconnectedGEOS ErrorInterior is disconnectedSelf-intersectionGEOS ErrorSelf-intersectionRing self-intersectionGEOS ErrorRing self-intersectionNested shellsGEOS ErrorNested shellsDuplicate ringsGEOS ErrorDuplicate ringsToo few points in geometry componentGEOS ErrorToo few points in geometry componentInvalid coordinateGEOS ErrorInvalid coordinateRing is not closedGEOS ErrorRing is not closedPolygon %1 has no ringsPolygon %1 has no ringsPolygon %1 lies inside polygon %2Polygon %1 lies inside polygon %2GEOS error: could not produce geometry for GEOS (check log window)GEOS error: could not produce geometry for GEOS (check log window)Unknown geometry type %1Unknown geometry type %1Geometry validation was aborted.Geometry validation was aborted.Geometry has %1 errors.Geometry has %1 errors.Geometry is valid.Geometry is valid.invalid lineinvalid lineShapeShapeNode ItemNode ItemMapMapPicturePictureLabelLabelLorem ipsumLorem ipsumScale BarScale BarRectangleRectangleEllipseEllipseTriangleTrianglePolygonPolygonPolylinePolylineHTMLHTMLAttribute TableAttribute TableConsoleConsoleinfiniteinfinite--WWEESSNNNo QGIS data provider plugins found in:
%1
No QGIS data provider plugins found in:
%1
No vector layers can be loaded. Check your QGIS installationNo vector layers can be loaded. Check your QGIS installationNo Data ProvidersNo Data ProvidersNo data provider plugins are available. No vector layers can be loadedNo data provider plugins are available. No vector layers can be loadedInvalid data provider %1Invalid data provider %1Unable to instantiate the data provider plugin %1Unable to instantiate the data provider plugin %1No QGIS auth method plugins found in:
%1
No QGIS auth method plugins found in:
%1
No authentication methods can be used. Check your QGIS installationNo authentication methods can be used. Check your QGIS installationNo Authentication MethodsNo Authentication MethodsNo authentication method plugins are available.No authentication method plugins are available.Failed to load %1: %2Failed to load %1: %2Unable to instantiate the auth method plugin %1Unable to instantiate the auth method plugin %1OGR driver for '%1' not found (OGR error: %2)OGR driver for '%1' not found (OGR error: %2)unsupported type for field %1unsupported type for field %1Invalid variant type for field %1[%2]: received %3 with type %4Invalid variant type for field %1[%2]: received %3 with type %4OGROGRReserved attribute name ogc_fid replaced with %1Reserved attribute name ogc_fid replaced with %1By default, BNA files are created in multi-line format. For each record, the first line contains the identifiers and the type/number of coordinates to follow. Each following line contains a pair of coordinates.By default, BNA files are created in multi-line format. For each record, the first line contains the identifiers and the type/number of coordinates to follow. Each following line contains a pair of coordinates.If the database is of the SpatiaLite flavor, and if OGR is linked against libspatialite, this option can be used to control if a spatial index must be created.If the database is of the SpatiaLite flavor, and if OGR is linked against libspatialite, this option can be used to control if a spatial index must be created.If the format of the geometry BLOB is of the SpatiaLite flavor, this option can be used to control if the compressed format for geometries (LINESTRINGs, POLYGONs) must be used.If the format of the geometry BLOB is of the SpatiaLite flavor, this option can be used to control if the compressed format for geometries (LINESTRINGs, POLYGONs) must be used.Path to the GCT: the GCT file describes the GeoConcept types definitions: In this file, every line must start with //# followed by a keyword. Lines starting with // are comments.Path to the GCT: the GCT file describes the GeoConcept types definitions: In this file, every line must start with //# followed by a keyword. Lines starting with // are comments.Defines the feature to be created. The TYPE corresponds to one of the Name found in the GCT file for a type section. The SUBTYPE corresponds to one of the Name found in the GCT file for a sub-type section within the previous type section.Defines the feature to be created. The TYPE corresponds to one of the Name found in the GCT file for a type section. The SUBTYPE corresponds to one of the Name found in the GCT file for a sub-type section within the previous type section.By default, the driver will read the first lines of each sheet to detect if the first line might be the name of columns. If set to FORCE, the driver will consider the first line as the header line. If set to DISABLE, it will be considered as the first feature. Otherwise auto-detection will occur.By default, the driver will read the first lines of each sheet to detect if the first line might be the name of columns. If set to FORCE, the driver will consider the first line as the header line. If set to DISABLE, it will be considered as the first feature. Otherwise auto-detection will occur.MS Office Open XML spreadsheet [XLSX]MS Office Open XML spreadsheet [XLSX]Open Document Spreadsheet [ODS]Open Document Spreadsheet [ODS]Feature geometry not imported (OGR error: %1)Feature geometry not imported (OGR error: %1)Feature creation error (OGR error: %1)Feature creation error (OGR error: %1)Failed to transform a point while drawing a feature with ID '%1'. Writing stopped. (Exception: %2)Failed to transform a point while drawing a feature with ID '%1'. Writing stopped. (Exception: %2)Feature write errors:Feature write errors:Stopping after %1 errorsStopping after %1 errors
Only %1 of %2 features written.
Only %1 of %2 features written.Arc/Info ASCII CoverageArc/Info ASCII CoverageAtlas BNAAtlas BNAComma Separated ValueComma Separated ValueESRI ShapefileESRI ShapefileFMEObjects GatewayFMEObjects GatewayEmpty filename givenEmpty filename givenNew BNA files are created by the systems default line termination conventions. This may be overridden here.New BNA files are created by the systems default line termination conventions. This may be overridden here.The BNA writer will try to recognize ellipses and circles when writing a polygon. This will only work if the feature has previously been read from a BNA file. As some software packages do not support ellipses/circles in BNA data file, it may be useful to tell the writer by specifying ELLIPSES_AS_ELLIPSES=NO not to export them as such, but keep them as polygons.The BNA writer will try to recognize ellipses and circles when writing a polygon. This will only work if the feature has previously been read from a BNA file. As some software packages do not support ellipses/circles in BNA data file, it may be useful to tell the writer by specifying ELLIPSES_AS_ELLIPSES=NO not to export them as such, but keep them as polygons.Limit the number of coordinate pairs per line in multiline format.Limit the number of coordinate pairs per line in multiline format.Set the number of decimal for coordinates. Default value is 10.Set the number of decimal for coordinates. Default value is 10.By default, the geometry of a feature written to a .csv file is discarded. It is possible to export the geometry in its WKT representation by specifying GEOMETRY=AS_WKT. It is also possible to export point geometries into their X,Y,Z components by specifying GEOMETRY=AS_XYZ, GEOMETRY=AS_XY or GEOMETRY=AS_YX.By default, the geometry of a feature written to a .csv file is discarded. It is possible to export the geometry in its WKT representation by specifying GEOMETRY=AS_WKT. It is also possible to export point geometries into their X,Y,Z components by specifying GEOMETRY=AS_XYZ, GEOMETRY=AS_XY or GEOMETRY=AS_YX.Create the associated .csvt file to describe the type of each column of the layer and its optional width and precision.Create the associated .csvt file to describe the type of each column of the layer and its optional width and precision.Double-quote strings. IF_AMBIGUOUS means that string values that look like numbers will be quoted.Double-quote strings. IF_AMBIGUOUS means that string values that look like numbers will be quoted.Write a UTF-8 Byte Order Mark (BOM) at the start of the file.Write a UTF-8 Byte Order Mark (BOM) at the start of the file.Comma Separated Value [CSV]Comma Separated Value [CSV]Set to YES to resize fields to their optimal size.Set to YES to resize fields to their optimal size.DBF FileDBF FileSet to YES to write a bbox property with the bounding box of the geometries at the feature and feature collection level.Set to YES to write a bbox property with the bounding box of the geometries at the feature and feature collection level.Maximum number of figures after decimal separator to write in coordinates. Default to 15. Truncation will occur to remove trailing zeros.Maximum number of figures after decimal separator to write in coordinates. Default to 15. Truncation will occur to remove trailing zeros.GeoJSONGeoJSONwhether the document must be in RSS 2.0 or Atom 1.0 format. Default value : RSSwhether the document must be in RSS 2.0 or Atom 1.0 format. Default value : RSSThe encoding of location information. Default value : SIMPLE. W3C_GEO only supports point geometries. SIMPLE or W3C_GEO only support geometries in geographic WGS84 coordinates.The encoding of location information. Default value : SIMPLE. W3C_GEO only supports point geometries. SIMPLE or W3C_GEO only support geometries in geographic WGS84 coordinates.If defined to NO, only <entry> or <item> elements will be written. The user will have to provide the appropriate header and footer of the document.If defined to NO, only <entry> or <item> elements will be written. The user will have to provide the appropriate header and footer of the document.Value put inside the <title> element in the header. If not provided, a dummy value will be used as that element is compulsory.Value put inside the <title> element in the header. If not provided, a dummy value will be used as that element is compulsory.Value put inside the <description> element in the header. If not provided, a dummy value will be used as that element is compulsory.Value put inside the <description> element in the header. If not provided, a dummy value will be used as that element is compulsory.Value put inside the <link> element in the header. If not provided, a dummy value will be used as that element is compulsory.Value put inside the <link> element in the header. If not provided, a dummy value will be used as that element is compulsory.Value put inside the <updated> element in the header. Should be formatted as a XML datetime. If not provided, a dummy value will be used as that element is compulsory.Value put inside the <updated> element in the header. Should be formatted as a XML datetime. If not provided, a dummy value will be used as that element is compulsory.Value put inside the <author><name> element in the header. If not provided, a dummy value will be used as that element is compulsory.Value put inside the <author><name> element in the header. If not provided, a dummy value will be used as that element is compulsory.Value put inside the <id> element in the header. If not provided, a dummy value will be used as that element is compulsory.Value put inside the <id> element in the header. If not provided, a dummy value will be used as that element is compulsory.GeoRSSGeoRSSIf provided, this URI will be inserted as the schema location. Note that the schema file isn't actually accessed by OGR, so it is up to the user to ensure it will match the schema of the OGR produced GML data file.If provided, this URI will be inserted as the schema location. Note that the schema file isn't actually accessed by OGR, so it is up to the user to ensure it will match the schema of the OGR produced GML data file.This writes a GML application schema file to a corresponding .xsd file (with the same basename). If INTERNAL is used the schema is written within the GML file, but this is experimental and almost certainly not valid XML. OFF disables schema generation (and is implicit if XSISCHEMAURI is used).This writes a GML application schema file to a corresponding .xsd file (with the same basename). If INTERNAL is used the schema is written within the GML file, but this is experimental and almost certainly not valid XML. OFF disables schema generation (and is implicit if XSISCHEMAURI is used).This is the prefix for the application target namespace.This is the prefix for the application target namespace.Can be set to TRUE to avoid writing the prefix of the application target namespace in the GML file.Can be set to TRUE to avoid writing the prefix of the application target namespace in the GML file.Defaults to 'http://ogr.maptools.org/'. This is the application target namespace.Defaults to 'http://ogr.maptools.org/'. This is the application target namespace.If not specified, GML2 will be used.If not specified, GML2 will be used.only valid when FORMAT=GML3/GML3Degree/GML3.2) Default to YES. If set to NO, the <gml:boundedBy> element will not be written for each feature.only valid when FORMAT=GML3/GML3Degree/GML3.2) Default to YES. If set to NO, the <gml:boundedBy> element will not be written for each feature.Default to YES. If YES, the output will be indented with spaces for more readability, but at the expense of file size.Default to YES. If YES, the output will be indented with spaces for more readability, but at the expense of file size.Geography Markup Language [GML]Geography Markup Language [GML]Human-readable identifier (e.g. short name) for the layer contentHuman-readable identifier (e.g. short name) for the layer contentHuman-readable description for the layer contentHuman-readable description for the layer contentName for the feature identifier columnName for the feature identifier columnName for the geometry columnName for the geometry columnIf a spatial index must be created.If a spatial index must be created.Generic Mapping Tools [GMT]Generic Mapping Tools [GMT]By default when writing a layer whose features are of type wkbLineString, the GPX driver chooses to write them as routes. If FORCE_GPX_TRACK=YES is specified, they will be written as tracks.By default when writing a layer whose features are of type wkbLineString, the GPX driver chooses to write them as routes. If FORCE_GPX_TRACK=YES is specified, they will be written as tracks.By default when writing a layer whose features are of type wkbMultiLineString, the GPX driver chooses to write them as tracks. If FORCE_GPX_ROUTE=YES is specified, they will be written as routes, provided that the multilines are composed of only one single line.By default when writing a layer whose features are of type wkbMultiLineString, the GPX driver chooses to write them as tracks. If FORCE_GPX_ROUTE=YES is specified, they will be written as routes, provided that the multilines are composed of only one single line.If GPX_USE_EXTENSIONS=YES is specified, extra fields will be written inside the <extensions> tag.If GPX_USE_EXTENSIONS=YES is specified, extra fields will be written inside the <extensions> tag.Only used if GPX_USE_EXTENSIONS=YES and GPX_EXTENSIONS_NS_URL is set. The namespace value used for extension tags. By default, 'ogr'.Only used if GPX_USE_EXTENSIONS=YES and GPX_EXTENSIONS_NS_URL is set. The namespace value used for extension tags. By default, 'ogr'.Only used if GPX_USE_EXTENSIONS=YES and GPX_EXTENSIONS_NS is set. The namespace URI. By default, 'http://osgeo.org/gdal'.Only used if GPX_USE_EXTENSIONS=YES and GPX_EXTENSIONS_NS is set. The namespace URI. By default, 'http://osgeo.org/gdal'.By default files are created with the line termination conventions of the local platform (CR/LF on win32 or LF on all other systems). This may be overridden through use of the LINEFORMAT layer creation option which may have a value of CRLF (DOS format) or LF (Unix format).By default files are created with the line termination conventions of the local platform (CR/LF on win32 or LF on all other systems). This may be overridden through use of the LINEFORMAT layer creation option which may have a value of CRLF (DOS format) or LF (Unix format).GPS eXchange Format [GPX]GPS eXchange Format [GPX]INTERLIS 1INTERLIS 1INTERLIS 2INTERLIS 2Allows you to specify the field to use for the KML <description> element.Allows you to specify the field to use for the KML <description> element.Allows you to specify the AltitudeMode to use for KML geometries. This will only affect 3D geometries and must be one of the valid KML options.Allows you to specify the AltitudeMode to use for KML geometries. This will only affect 3D geometries and must be one of the valid KML options.Keyhole Markup Language [KML]Keyhole Markup Language [KML]Use this to turn on 'quick spatial index mode'. In this mode writing files can be about 5 times faster, but spatial queries can be up to 30 times slower.Use this to turn on 'quick spatial index mode'. In this mode writing files can be about 5 times faster, but spatial queries can be up to 30 times slower.Mapinfo TABMapinfo TABMapinfo MIFMapinfo MIFDetermine whether 2D (seed_2d.dgn) or 3D (seed_3d.dgn) seed file should be used. This option is ignored if the SEED option is provided.Determine whether 2D (seed_2d.dgn) or 3D (seed_3d.dgn) seed file should be used. This option is ignored if the SEED option is provided.Override the seed file to use.Override the seed file to use.Indicate whether the whole seed file should be copied. If not, only the first three elements will be copied.Indicate whether the whole seed file should be copied. If not, only the first three elements will be copied.Indicates whether the color table should be copied from the seed file.Indicates whether the color table should be copied from the seed file.Override the master unit name from the seed file with the provided one or two character unit name.Override the master unit name from the seed file with the provided one or two character unit name.Override the sub unit name from the seed file with the provided one or two character unit name.Override the sub unit name from the seed file with the provided one or two character unit name.Override the number of subunits per master unit. By default the seed file value is used.Override the number of subunits per master unit. By default the seed file value is used.Override the number of UORs (Units of Resolution) per sub unit. By default the seed file value is used.Override the number of UORs (Units of Resolution) per sub unit. By default the seed file value is used.ORIGIN=x,y,z: Override the origin of the design plane. By default the origin from the seed file is used.ORIGIN=x,y,z: Override the origin of the design plane. By default the origin from the seed file is used.Microstation DGNMicrostation DGNShould all the low level geometry primitives be returned as special IsolatedNode, ConnectedNode, Edge and Face layers.Should all the low level geometry primitives be returned as special IsolatedNode, ConnectedNode, Edge and Face layers.If enabled, numeric attributes assigned an empty string as a value will be preserved as a special numeric value. This option should not generally be needed, but may be useful when translated S-57 to S-57 losslessly.If enabled, numeric attributes assigned an empty string as a value will be preserved as a special numeric value. This option should not generally be needed, but may be useful when translated S-57 to S-57 losslessly.Should LNAM and LNAM_REFS fields be attached to features capturing the feature to feature relationships in the FFPT group of the S-57 file.Should LNAM and LNAM_REFS fields be attached to features capturing the feature to feature relationships in the FFPT group of the S-57 file.Should additional attributes relating features to their underlying geometric primitives be attached. These are the values of the FSPT group, and are primarily needed when doing S-57 to S-57 translations.Should additional attributes relating features to their underlying geometric primitives be attached. These are the values of the FSPT group, and are primarily needed when doing S-57 to S-57 translations.Should attribute values be recoded to UTF-8 from the character encoding specified in the S57 DSSI record.Should attribute values be recoded to UTF-8 from the character encoding specified in the S57 DSSI record.S-57 Base fileS-57 Base fileSpatial Data Transfer Standard [SDTS]Spatial Data Transfer Standard [SDTS]Can be used to avoid creating the geometry_columns and spatial_ref_sys tables in a new database. By default these metadata tables are created when a new database is created.Can be used to avoid creating the geometry_columns and spatial_ref_sys tables in a new database. By default these metadata tables are created when a new database is created.column_name1[,column_name2, ...] A list of (String) columns that must be compressed with ZLib DEFLATE algorithm. This might be beneficial for databases that have big string blobs. However, use with care, since the value of such columns will be seen as compressed binary content with other SQLite utilities (or previous OGR versions). With OGR, when inserting, modifying or queryings compressed columns, compression/decompression is done transparently. However, such columns cannot be (easily) queried with an attribute filter or WHERE clause. Note: in table definition, such columns have the 'VARCHAR_deflate' declaration type.column_name1[,column_name2, ...] A list of (String) columns that must be compressed with ZLib DEFLATE algorithm. This might be beneficial for databases that have big string blobs. However, use with care, since the value of such columns will be seen as compressed binary content with other SQLite utilities (or previous OGR versions). With OGR, when inserting, modifying or queryings compressed columns, compression/decompression is done transparently. However, such columns cannot be (easily) queried with an attribute filter or WHERE clause. Note: in table definition, such columns have the 'VARCHAR_deflate' declaration type.By default when creating new .csv files they are created with the line termination conventions of the local platform (CR/LF on Win32 or LF on all other systems). This may be overridden through the use of the LINEFORMAT option.By default when creating new .csv files they are created with the line termination conventions of the local platform (CR/LF on Win32 or LF on all other systems). This may be overridden through the use of the LINEFORMAT option.Creation of data source failed (OGR error: %1)Creation of data source failed (OGR error: %1)Opening of data source in update mode failed (OGR error: %1)Opening of data source in update mode failed (OGR error: %1)Overwriting of existing layer failed (OGR error: %1)Overwriting of existing layer failed (OGR error: %1)Creation of layer failed (OGR error: %1)Creation of layer failed (OGR error: %1)Opening of layer failed (OGR error: %1)Opening of layer failed (OGR error: %1)No available replacement for internal fieldname ogc_fid foundNo available replacement for internal fieldname ogc_fid foundCreation of field %1 failed (OGR error: %2)Creation of field %1 failed (OGR error: %2)Created field %1 not found (OGR error: %2)Created field %1 not found (OGR error: %2)BNA records may contain from 2 to 4 identifiers per record. Some software packages only support a precise number of identifiers. You can override the default value (2) by a precise value.BNA records may contain from 2 to 4 identifiers per record. Some software packages only support a precise number of identifiers. You can override the default value (2) by a precise value.Field separator character.Field separator character.Override the type of shapefile created. Can be one of NULL for a simple .dbf file with no .shp file, POINT, ARC, POLYGON or MULTIPOINT for 2D, or POINTZ, ARCZ, POLYGONZ or MULTIPOINTZ for 3D;Override the type of shapefile created. Can be one of NULL for a simple .dbf file with no .shp file, POINT, ARC, POLYGON or MULTIPOINT for 2D, or POINTZ, ARCZ, POLYGONZ or MULTIPOINTZ for 3D; POINTM, ARCM, POLYGONM or MULTIPOINTM for measured geometries and POINTZM, ARCZM, POLYGONZM or MULTIPOINTZM for 3D measured geometries. POINTM, ARCM, POLYGONM or MULTIPOINTM for measured geometries and POINTZM, ARCZM, POLYGONZM or MULTIPOINTZM for 3D measured geometries. MULTIPATCH files are supported since GDAL 2.2. MULTIPATCH files are supported since GDAL 2.2.Set the encoding value in the DBF file. The default value is LDID/87. It is not clear what other values may be appropriate.Set the encoding value in the DBF file. The default value is LDID/87. It is not clear what other values may be appropriate.If defined to YES, extension fields will be written. If the field name not found in the base schema matches the foo_bar pattern, foo will be considered as the namespace of the element, and a <foo:bar> element will be written. Otherwise, elements will be written in the <ogr:> namespace.If defined to YES, extension fields will be written. If the field name not found in the base schema matches the foo_bar pattern, foo will be considered as the namespace of the element, and a <foo:bar> element will be written. Otherwise, elements will be written in the <ogr:> namespace.XML content that will be put between the <channel> element and the first <item> element for a RSS document, or between the xml tag and the first <entry> element for an Atom document.XML content that will be put between the <channel> element and the first <item> element for a RSS document, or between the xml tag and the first <entry> element for an Atom document.Only valid when FORMAT=GML3/GML3Degree/GML3.2. Default to YES. If YES, SRS with EPSG authority will be written with the 'urn:ogc:def:crs:EPSG::' prefix. In the case the SRS is a geographic SRS without explicit AXIS order, but that the same SRS authority code imported with ImportFromEPSGA() should be treated as lat/long, then the function will take care of coordinate order swapping. If set to NO, SRS with EPSG authority will be written with the 'EPSG:' prefix, even if they are in lat/long order.Only valid when FORMAT=GML3/GML3Degree/GML3.2. Default to YES. If YES, SRS with EPSG authority will be written with the 'urn:ogc:def:crs:EPSG::' prefix. In the case the SRS is a geographic SRS without explicit AXIS order, but that the same SRS authority code imported with ImportFromEPSGA() should be treated as lat/long, then the function will take care of coordinate order swapping. If set to NO, SRS with EPSG authority will be written with the 'EPSG:' prefix, even if they are in lat/long order.Allows you to specify the field to use for the KML <name> element.Allows you to specify the field to use for the KML <name> element.The DOCUMENT_ID datasource creation option can be used to specified the id of the root <Document> node. The default value is root_doc.The DOCUMENT_ID datasource creation option can be used to specified the id of the root <Document> node. The default value is root_doc.(multiples of 512): Block size for .map files. Defaults to 512. MapInfo 15.2 and above creates .tab files with a blocksize of 16384 bytes. Any MapInfo version should be able to handle block sizes from 512 to 32256.(multiples of 512): Block size for .map files. Defaults to 512. MapInfo 15.2 and above creates .tab files with a blocksize of 16384 bytes. Any MapInfo version should be able to handle block sizes from 512 to 32256.xmin,ymin,xmax,ymax: Define custom layer bounds to increase the accuracy of the coordinates. Note: the geometry of written features must be within the defined box.xmin,ymin,xmax,ymax: Define custom layer bounds to increase the accuracy of the coordinates. Note: the geometry of written features must be within the defined box.Should update files be incorporated into the base data on the fly.Should update files be incorporated into the base data on the fly.Should multipoint soundings be split into many single point sounding features. Multipoint geometries are not well handled by many formats, so it can be convenient to split single sounding features with many points into many single point features.Should multipoint soundings be split into many single point sounding features. Multipoint geometries are not well handled by many formats, so it can be convenient to split single sounding features with many points into many single point features.Should a DEPTH attribute be added on SOUNDG features and assign the depth of the sounding. This should only be enabled when SPLIT_MULTIPOINT is also enabled.Should a DEPTH attribute be added on SOUNDG features and assign the depth of the sounding. This should only be enabled when SPLIT_MULTIPOINT is also enabled.Controls the format used for the geometry column. Defaults to WKB. This is generally more space and processing efficient, but harder to inspect or use in simple applications than WKT (Well Known Text).Controls the format used for the geometry column. Defaults to WKB. This is generally more space and processing efficient, but harder to inspect or use in simple applications than WKT (Well Known Text).Controls whether layer and field names will be laundered for easier use in SQLite. Laundered names will be converted to lower case and some special characters(' - #) will be changed to underscores.Controls whether layer and field names will be laundered for easier use in SQLite. Laundered names will be converted to lower case and some special characters(' - #) will be changed to underscores.column_name1[,column_name2, ...] A list of (String) columns that must be compressed with ZLib DEFLATE algorithm. This might be beneficial for databases that have big string blobs. However, use with care, since the value of such columns will be seen as compressed binary content with other SQLite utilities (or previous OGR versions). With OGR, when inserting, modifying or querying compressed columns, compression/decompression is done transparently. However, such columns cannot be (easily) queried with an attribute filter or WHERE clause. Note: in table definition, such columns have the 'VARCHAR_deflate' declaration type.column_name1[,column_name2, ...] A list of (String) columns that must be compressed with ZLib DEFLATE algorithm. This might be beneficial for databases that have big string blobs. However, use with care, since the value of such columns will be seen as compressed binary content with other SQLite utilities (or previous OGR versions). With OGR, when inserting, modifying or querying compressed columns, compression/decompression is done transparently. However, such columns cannot be (easily) queried with an attribute filter or WHERE clause. Note: in table definition, such columns have the 'VARCHAR_deflate' declaration type.SQLiteSQLiteInsert the content of the EPSG CSV files into the spatial_ref_sys table. Set to NO for regular SQLite databases.Insert the content of the EPSG CSV files into the spatial_ref_sys table. Set to NO for regular SQLite databases.Used to force the SRID number of the SRS associated with the layer. When this option isn't specified and that a SRS is associated with the layer, a search is made in the spatial_ref_sys to find a match for the SRS, and, if there is no match, a new entry is inserted for the SRS in the spatial_ref_sys table. When the SRID option is specified, this search (and the eventual insertion of a new entry) will not be done: the specified SRID is used as such.Used to force the SRID number of the SRS associated with the layer. When this option isn't specified and that a SRS is associated with the layer, a search is made in the spatial_ref_sys to find a match for the SRS, and, if there is no match, a new entry is inserted for the SRS in the spatial_ref_sys table. When the SRID option is specified, this search (and the eventual insertion of a new entry) will not be done: the specified SRID is used as such.SpatiaLiteSpatiaLiteOverride the header file used - in place of header.dxf.Override the header file used - in place of header.dxf.Override the trailer file used - in place of trailer.dxf.Override the trailer file used - in place of trailer.dxf.AutoCAD DXFAutoCAD DXFIndicates the GeoConcept export file extension. TXT was used by earlier releases of GeoConcept. GXT is currently used.Indicates the GeoConcept export file extension. TXT was used by earlier releases of GeoConcept. GXT is currently used.GeoconceptGeoconceptWhen this option is set, the new layer will be created inside the named FeatureDataset folder. If the folder does not already exist, it will be created.When this option is set, the new layer will be created inside the named FeatureDataset folder. If the folder does not already exist, it will be created.Set name of geometry column in new layer. Defaults to 'SHAPE'.Set name of geometry column in new layer. Defaults to 'SHAPE'.Name of the OID column to create. Defaults to 'OBJECTID'.Name of the OID column to create. Defaults to 'OBJECTID'.ESRI FileGDBESRI FileGDBBy default, the driver will try to detect the data type of fields. If set to STRING, all fields will be of String type.By default, the driver will try to detect the data type of fields. If set to STRING, all fields will be of String type.Cannot overwrite a OGR layer in placeCannot overwrite a OGR layer in placeFailed to transform, writing stopped. (Exception: %1)Failed to transform, writing stopped. (Exception: %1)Unable to load %1 providerUnable to load %1 providerProvider %1 has no %2 methodProvider %1 has no %2 methodLoaded from ProviderLoaded from ProviderLoading of layer failedLoading of layer failedCreation error for features from #%1 to #%2. Provider errors was:
%3Creation error for features from #%1 to #%2. Provider errors was:
%3Import was canceled at %1 of %2Import was canceled at %1 of %2Vector importVector importOnly %1 of %2 features written.Only %1 of %2 features written.Write access denied. Adjust the file permissions and try again.Write access denied. Adjust the file permissions and try again.Building PyramidsBuilding PyramidsThe file was not writable. Some formats do not support pyramid overviews. Consult the GDAL documentation if in doubt.The file was not writable. Some formats do not support pyramid overviews. Consult the GDAL documentation if in doubt.Building pyramid overviews is not supported on this type of raster.Building pyramid overviews is not supported on this type of raster.Multiband colorMultiband colorPaletted/Unique valuesPaletted/Unique valuesSingleband graySingleband graySingleband pseudocolorSingleband pseudocolorSingleband color dataSingleband color dataHillshadeHillshadeAll RampsAll RampsNo symbolsNo symbolsSingle symbolSingle symbolCategorizedCategorizedGraduatedGraduatedRule-basedRule-basedPoint displacementPoint displacementPoint clusterPoint clusterInverted polygonsInverted polygons2.5 D2.5 DSimple lineSimple lineMarker lineMarker lineArrowArrowSimple markerSimple markerFilled markerFilled markerSVG markerSVG markerFont markerFont markerEllipse markerEllipse markerVector field markerVector field markerSimple fillSimple fillGradient fillGradient fillShapeburst fillShapeburst fillSVG fillSVG fillCentroid fillCentroid fillLine pattern fillLine pattern fillPoint pattern fillPoint pattern fillGeometry generatorGeometry generatorRaster HistogramRaster HistogramPixel ValuePixel ValueFrequencyFrequencyInternal CompassInternal CompassShows a QtSensors compass readingShows a QtSensors compass readingVersion 0.9Version 0.9Coordinate CaptureCoordinate CaptureCapture mouse coordinates in different CRSCapture mouse coordinates in different CRSVectorVectorVersion 0.1Version 0.1eViseVisAn event visualization tool - view images associated with vector featuresAn event visualization tool - view images associated with vector featuresPackage layersPackage layersgeopackage,collect,merge,combinegeopackage,collect,merge,combineDatabaseDatabaseDestination GeoPackageDestination GeoPackageGeoPackage files (*.gpkg)GeoPackage files (*.gpkg)Overwrite existing GeoPackageOverwrite existing GeoPackageLayers within new packageLayers within new packageThis algorithm collects a number of existing layers and packages them together into a single GeoPackage database.This algorithm collects a number of existing layers and packages them together into a single GeoPackage database.No output file specified.No output file specified.Removing existing file '%1'Removing existing file '%1'Could not remove existing file '%1'Could not remove existing file '%1'GeoPackage driver not found.GeoPackage driver not found.Creation of database failed (OGR error: %1)Creation of database failed (OGR error: %1)Raster layers are not currently supported.Raster layers are not currently supported.Packaging plugin layers is not supported.Packaging plugin layers is not supported.Packaging mesh layers is not supported.Packaging mesh layers is not supported.Error obtained while packaging one or more layers.Error obtained while packaging one or more layers.Packaging layer failed: %1Packaging layer failed: %1Version 1.1.0Version 1.1.0WarningWarningGeoreferencer GDALGeoreferencer GDALGeoreferencing rasters using GDALGeoreferencing rasters using GDALRasterRasterCould not reproject view extent: %1Could not reproject view extent: %1Could not reproject layer extent: %1Could not reproject layer extent: %1Version 3.1.9Version 3.1.9Fit to a linear transform requires at least 2 points.Fit to a linear transform requires at least 2 points.Fit to a Helmert transform requires at least 2 points.Fit to a Helmert transform requires at least 2 points.Fit to an affine transform requires at least 4 points.Fit to an affine transform requires at least 4 points.Fitting a projective transform requires at least 4 corresponding points.Fitting a projective transform requires at least 4 corresponding points.GlobeGlobeOverlay data on a 3D globeOverlay data on a 3D globeVersion 1.0Version 1.0GPS ToolsGPS ToolsTools for loading and importing GPS dataTools for loading and importing GPS dataHeatmapHeatmapOfflineEditingOfflineEditingAllow offline editing and synchronizing with databaseAllow offline editing and synchronizing with databaseEqual to (=)Equal to (=)Greater than (>)Greater than (>)Less than (<)Less than (<)Not equal to (≠)Not equal to (≠)Greater than or equal to (≥)Greater than or equal to (≥)Less than or equal to (≤)Less than or equal to (≤)Between (inclusive)Between (inclusive)Not between (inclusive)Not between (inclusive)Case insensitiveCase insensitiveContainsContainsDoes not containDoes not containIs missing (null)Is missing (null)Is not missing (not null)Is not missing (not null)Starts withStarts withEnds withEnds withGDAL/OGR VSIFileHandlerGDAL/OGR VSIFileHandlerThis raster file has no bands and is invalid as a raster layer.This raster file has no bands and is invalid as a raster layer.Cannot get GDAL raster band: %1Cannot get GDAL raster band: %1Nearest NeighbourNearest NeighbourAverageAverageGaussGaussCubicCubicCubic SplineCubic SplineLanczosLanczosModeModeNoneNoneCouldn't open the data source: %1Couldn't open the data source: %1Parse error at line %1 : %2Parse error at line %1 : %2GPS eXchange format providerGPS eXchange format providerChoose GRASS installation path (GISBASE)Choose GRASS installation path (GISBASE)GISBASE is not set.GISBASE is not set.%1 is not a GRASS mapset.%1 is not a GRASS mapset.Cannot start %1Cannot start %1Mapset is already in use.Mapset is already in use.Mapset lock failed (%1)Mapset lock failed (%1)Temporary directory %1 exists but is not writableTemporary directory %1 exists but is not writableCannot create temporary directory %1Cannot create temporary directory %1Cannot create %1Cannot create %1Cannot remove mapset lock: %1Cannot remove mapset lock: %1Cannot create table: %1Cannot create table: %1Cannot read vector map regionCannot read vector map regionCannot find module %1Cannot find module %1Cannot open GISRC fileCannot open GISRC fileCannot run moduleCannot run modulecommand: %1 %2
stdout: %3
stderr: %4command: %1 %2
stdout: %3
stderr: %4Attempt to copy from different location.Attempt to copy from different location.Delete confirmationDelete confirmationAre you sure you want to delete %1 %2?Are you sure you want to delete %1 %2?Cannot insert, statement: '%1' error: '%2'Cannot insert, statement: '%1' error: '%2'Loading of the MSSQL provider failedLoading of the MSSQL provider failedUnsupported type for field %1Unsupported type for field %1Creation of fields failedCreation of fields failedOGR[%1] error %2: %3OGR[%1] error %2: %3Unable to create the datasource. %1 exists and overwrite flag is false.Unable to create the datasource. %1 exists and overwrite flag is false.Unable to get driver %1Unable to get driver %1Arc/Info Binary CoverageArc/Info Binary CoverageDODSDODSCouchDBCouchDBOpenFileGDBOpenFileGDBESRI Personal GeoDatabaseESRI Personal GeoDatabaseLayer %2 of %1 exists and overwrite flag is false.Layer %2 of %1 exists and overwrite flag is false.ESRI ArcSDEESRI ArcSDEESRI ShapefilesESRI ShapefilesGeoPackageGeoPackageGrass VectorGrass VectorInformix DataBladeInformix DataBladeIngresIngresMapinfo FileMapinfo FileMySQLMySQLMSSQLMSSQLOracle SpatialOracle SpatialODBCODBCOGDI VectorsOGDI VectorsPostgreSQLPostgreSQLSystematic Organization of Spatial Information [SOSI]Systematic Organization of Spatial Information [SOSI]SQLite/SpatiaLiteSQLite/SpatiaLiteStorage and eXchange FormatStorage and eXchange FormatUK. NTF2UK. NTF2U.S. Census TIGER/LineU.S. Census TIGER/LineVRT - Virtual DatasourceVRT - Virtual DatasourceX-Plane/FlightgearX-Plane/FlightgearOpen Document SpreadsheetOpen Document SpreadsheetMS Office Open XML spreadsheetMS Office Open XML spreadsheetMS Excel formatMS Excel formatEDIGEOEDIGEONAS - ALKISNAS - ALKISWAsPWAsPPCI Geomatics Database FilePCI Geomatics Database FileGPSTrackMakerGPSTrackMakerCzech Cadastral Exchange Data FormatCzech Cadastral Exchange Data FormatOpenStreetMapOpenStreetMapSpecial Use Airspace FormatSpecial Use Airspace FormatOpenAir Special Use Airspace FormatOpenAir Special Use Airspace FormatPlanetary Data Systems TABLEPlanetary Data Systems TABLEHydrographic Transfer FormatHydrographic Transfer FormatScalable Vector GraphicsScalable Vector GraphicsArc/Info GenerateArc/Info GenerateGeospatial PDFGeospatial PDFSEG-YSEG-YSEG-P1SEG-P1UKOOA P1/90UKOOA P1/90Error updating styleError updating styleCannot find layer_styles layerCannot find layer_styles layerInvalid style identifierInvalid style identifierNo style corresponding to style identifierNo style corresponding to style identifierNot enough data to deserializeNot enough data to deserializeNot enough memoryNot enough memoryUnsupported geometry typeUnsupported geometry typeUnsupported operationUnsupported operationCorrupt dataCorrupt dataFailureFailureUnsupported SRSUnsupported SRSInvalid handleInvalid handleNon existing featureNon existing featureSuccessSuccessGDAL result code: %1GDAL result code: %1Layer not found: %1Layer not found: %1GeoPackage Database (*.gpkg)GeoPackage Database (*.gpkg)Cannot open transaction on %1, since it is is not currently openedCannot open transaction on %1, since it is is not currently openedAll filesAll filesDuplicate field (10 significant characters): %1Duplicate field (10 significant characters): %1Creating the data source %1 failed: %2Creating the data source %1 failed: %2Unknown vector type of %1Unknown vector type of %1Creation of OGR data source %1 failed: %2Creation of OGR data source %1 failed: %2field %1 with unsupported type %2 skippedfield %1 with unsupported type %2 skippedcreation of field %1 failedcreation of field %1 failedCouldn't create file %1.qpjCouldn't create file %1.qpjFetching features failed.
SQL: %1
Error: %2Fetching features failed.
SQL: %1
Error: %2OracleOracleConnection to database failedConnection to database failedNo owner name foundNo owner name foundCreation of data source %1 failed:
%2Creation of data source %1 failed:
%2Loading of the layer %1 failedLoading of the layer %1 failedField name clash found (%1 not remappable)Field name clash found (%1 not remappable)%1 not owner of the table %2.%1 not owner of the table %2.Unable to determine number of geometry columns of layer %1.%2:
%3Unable to determine number of geometry columns of layer %1.%2:
%3Unable to delete layer %1.%2:
%3Unable to delete layer %1.%2:
%3Unable to clean metadata %1.%2:
%3Unable to clean metadata %1.%2:
%3Could not connect to databaseCould not connect to databaseUnable to check layer style existence [%1]Unable to check layer style existence [%1]Unable to create layer style table [%1]Unable to create layer style table [%1]Unable to check style existence [%1]Unable to check style existence [%1]Unable to find layer style table [%1]Unable to find layer style table [%1]Layer style table does not exist [%1]Layer style table does not exist [%1]Could not load layer style table [%1]Could not load layer style table [%1]Cannot fetch new layer style id.Cannot fetch new layer style id.Could not prepare insert/update [%1]Could not prepare insert/update [%1]Could not execute insert/update [%1]Could not execute insert/update [%1]Could not reset default status [%1]Could not reset default status [%1]Could not retrieve style [%1]Could not retrieve style [%1]Style not foundStyle not foundCould not verify existence of layer style table [%1]Could not verify existence of layer style table [%1]No style for layer foundNo style for layer foundNo styles found in layer table [%1]No styles found in layer table [%1]no result bufferno result bufferFetching from cursor %1 failed
Database error: %2Fetching from cursor %1 failed
Database error: %2PostGISPostGISInfinite filter rectangle specifiedInfinite filter rectangle specifiedUnable to delete layer %1:
%2Unable to delete layer %1:
%2Unable to delete schema %1:
%2Unable to delete schema %1:
%2Unable to save layer style. It's not possible to create the destination table on the database. Maybe this is due to table permissions (user=%1). Please contact your database adminUnable to save layer style. It's not possible to create the destination table on the database. Maybe this is due to table permissions (user=%1). Please contact your database adminUnable to save layer style. It's not possible to create the destination table on the database. Maybe this is due to table permissions. Please contact your database adminUnable to save layer style. It's not possible to create the destination table on the database. Maybe this is due to table permissions. Please contact your database adminSave style in databaseSave style in databaseA style named "%1" already exists in the database for this layer. Do you want to overwrite it?A style named "%1" already exists in the database for this layer. Do you want to overwrite it?Operation aborted. No changes were made in the databaseOperation aborted. No changes were made in the databaseUnable to save layer style. It's not possible to insert a new record into the style table. Maybe this is due to table permissions. Please contact your database administrator.Unable to save layer style. It's not possible to insert a new record into the style table. Maybe this is due to table permissions. Please contact your database administrator.No styles available on DB, or there is an error connecting to the database.No styles available on DB, or there is an error connecting to the database.Unable to save layer style. It's not possible to insert a new record into the style table. Maybe this is due to table permissions (user=%1). Please contact your database administrator.Unable to save layer style. It's not possible to insert a new record into the style table. Maybe this is due to table permissions (user=%1). Please contact your database administrator.Connection to database failed using username: %1Connection to database failed using username: %1Error executing query: %1Error executing query: %1Error executing the select query for related styles. The query was loggedError executing the select query for related styles. The query was loggedError executing the select query for unrelated styles. The query was loggedError executing the select query for unrelated styles. The query was loggedError executing the delete query. The query was loggedError executing the delete query. The query was loggedError executing the select query. The query was loggedError executing the select query. The query was loggedConsistency error in table '%1'. Style id should be uniqueConsistency error in table '%1'. Style id should be uniqueSQLite error: %2
SQL: %1SQLite error: %2
SQL: %1SQLite error getting feature: %1SQLite error getting feature: %1creation of data source %1 failed. %2creation of data source %1 failed. %2loading of the layer %1 failedloading of the layer %1 failedcreation of fields failedcreation of fields failedUnable to initialize SpatialMetadata:
Unable to initialize SpatialMetadata:
Could not create a new database
Could not create a new database
Unable to activate FOREIGN_KEY constraints [%1]Unable to activate FOREIGN_KEY constraints [%1]Unable to delete table %1
Unable to delete table %1
Could not load styles from %1 (Query: %2)Could not load styles from %1 (Query: %2)Style with id %1 not found in %2 (Query: %3)Style with id %1 not found in %2 (Query: %3)Error looking for style. The query was loggedError looking for style. The query was loggedUnable to save layer style. It's not possible to create the destination table on the database.Unable to save layer style. It's not possible to create the destination table on the database.Cannot find layer %1.Cannot find layer %1.Cannot open %1.Cannot open %1.Operation abortedOperation abortedError executing loading style. The query was loggedError executing loading style. The query was loggedNo styles available on DBNo styles available on DBError loading styles. The query was loggedError loading styles. The query was loggedThe extra plugin path '%1' does not exist!The extra plugin path '%1' does not exist!Couldn't load SIP module.Couldn't load SIP module.Python support will be disabled.Python support will be disabled.Couldn't set SIP API versions.Couldn't set SIP API versions.Couldn't load PyQt.Couldn't load PyQt.Couldn't load PyQGIS.Couldn't load PyQGIS.Couldn't load QGIS utils.Couldn't load QGIS utils.An error occurred during execution of following code:An error occurred during execution of following code:Python version:Python version:QGIS version:QGIS version:Python path:Python path:Python errorPython errorUndefinedUndefinedHiddenHiddenTitleTitleGroupGroupFrameFrameScalebarScalebarText TableText TableSubgroupSubgroupSymbolSymbolSymbol labelSymbol labelTopology CheckerTopology CheckerA Plugin for finding topological errors in vector layersA Plugin for finding topological errors in vector layersUsing fix %1.Using fix %1.Topology pluginTopology pluginSelect automatic fixSelect automatic fixintersecting geometriesintersecting geometriesMove blue featureMove blue featureMove red featureMove red featureDelete blue featureDelete blue featureDelete red featureDelete red featureUnion to blue featureUnion to blue featureUnion to red featureUnion to red featurefeatures too closefeatures too closeSnap to segmentSnap to segmentpoint not covered by segmentpoint not covered by segmentDelete pointDelete pointsegment too shortsegment too shortDelete featureDelete featureinvalid geometryinvalid geometrydangling enddangling endduplicate geometryduplicate geometrypseudo nodepseudo nodeoverlapsoverlapsgapsgapspoint not coveredpoint not coveredline ends not covered by pointline ends not covered by pointpoint not in polygonpoint not in polygonpolygon does not contain pointpolygon does not contain pointmultipart featuremultipart featureSave style to DB (%1)Save style to DB (%1)Delete Auxiliary FieldDelete Auxiliary FieldUnable to remove auxiliary field (%1)Unable to remove auxiliary field (%1)Could not save metadataCould not save metadataCould not save symbology because:
%1Could not save symbology because:
%1Attribute index %1 out of bounds [0;%2]Attribute index %1 out of bounds [0;%2]ErrorErrorGlobalGlobalFormFormProjectProjectLoad layer into projectLoad layer into projectload,open,layer,raster,vector,projectload,open,layer,raster,vector,projectModeler toolsModeler toolsThis algorithm loads a layer to the current project.This algorithm loads a layer to the current project.LayerLayerLoaded layer nameLoaded layer nameInvalid input layerInvalid input layerInvalid (empty) layer nameInvalid (empty) layer nameMap SettingsMap SettingsMap Tool CaptureMap Tool CaptureLayoutLayoutAtlasAtlasLayout ItemLayout ItemAlgorithmAlgorithmFeature IDFeature IDlinearlinearradialradialconicalconicalfeaturefeatureviewportviewportpadpadrepeatrepeatreflectreflectCould not allocate sufficient memory for shapeburst fillCould not allocate sufficient memory for shapeburst fillNo renderer for drawing.No renderer for drawing.Simplify transform error caught: %1Simplify transform error caught: %1empty capabilities documentempty capabilities documentDom ExceptionDom ExceptionCould not get WMS capabilities: %1 at line %2 column %3
This is probably due to an incorrect WMS Server URL.
Response was:
%4Could not get WMS capabilities: %1 at line %2 column %3
This is probably due to an incorrect WMS Server URL.
Response was:
%4Could not get WMS capabilities in the expected format (DTD): no %1 or %2 found.
This might be due to an incorrect WMS Server URL.
Tag: %3
Response was:
%4Could not get WMS capabilities in the expected format (DTD): no %1 or %2 found.
This might be due to an incorrect WMS Server URL.
Tag: %3
Response was:
%4Generated default styleGenerated default styleStyle was missing in capabilitiesStyle was missing in capabilitiesField contains a color.Field contains a color.Combo box with values that can be used within the column's type. Must be supported by the provider.Combo box with values that can be used within the column's type. Must be supported by the provider.Read-only field that generates a UUID if empty.Read-only field that generates a UUID if empty.LegendLegendRaster image fillRaster image fillCouldn't load PyQGIS Server.Couldn't load PyQGIS Server.Couldn't load qgis.user.Couldn't load qgis.user.NOTICE: %1NOTICE: %1BlurBlurDrop ShadowDrop ShadowInner ShadowInner ShadowStackStackOuter GlowOuter GlowInner GlowInner GlowSourceSourceTransformTransformColoriseColoriseGRASS %1GRASS %1GRASS %1 (Geographic Resources Analysis Support System)GRASS %1 (Geographic Resources Analysis Support System)Version 2.0Version 2.0GRASS editGRASS editExtract by attributeExtract by attributeextract,filter,attribute,value,contains,null,fieldextract,filter,attribute,value,contains,null,fieldVector selectionVector selectionSelection attributeSelection attributeOperatorOperator==≠≠>>>=>=<<<=<=begins withbegins withcontainscontainsis nullis nullis not nullis not nulldoes not containdoes not containValueValueExtracted (attribute)Extracted (attribute)Extracted (non-matching)Extracted (non-matching)This algorithm creates a new vector layer that only contains matching features from an input layer. The criteria for adding features to the resulting layer is defined based on the values of an attribute from the input layer.This algorithm creates a new vector layer that only contains matching features from an input layer. The criteria for adding features to the resulting layer is defined based on the values of an attribute from the input layer.Field '%1' was not found in INPUT sourceField '%1' was not found in INPUT sourceOperator '%1' can be used only with string fields.Operator '%1' can be used only with string fields.CountCountCount (distinct)Count (distinct)Count (missing)Count (missing)Minimum (earliest)Minimum (earliest)Maximum (latest)Maximum (latest)Range (interval)Range (interval)SumSumMeanMeanMedianMedianSt dev (pop)St dev (pop)St dev (sample)St dev (sample)Output no data valueOutput no data valueRange boundariesRange boundariesmin < value <= maxmin < value <= maxmin <= value < maxmin <= value < maxmin <= value <= maxmin <= value <= maxmin < value < maxmin < value < maxUse no data when no range matches valueUse no data when no range matches valueOutput data typeOutput data typeReclassified rasterReclassified rasterInvalid band number for RASTER_BAND (%1): Valid values for input raster are 1 to %2Invalid band number for RASTER_BAND (%1): Valid values for input raster are 1 to %2Could not create raster output: %1Could not create raster output: %1Could not create raster output %1: %2Could not create raster output %1: %2Reclassify by layerReclassify by layerraster,reclassify,classes,calculatorraster,reclassify,classes,calculatorThis algorithm reclassifies a raster band by assigning new class values based on the ranges specified in a vector table.This algorithm reclassifies a raster band by assigning new class values based on the ranges specified in a vector table.Layer containing class breaksLayer containing class breaksMinimum class value fieldMinimum class value fieldMaximum class value fieldMaximum class value fieldOutput value fieldOutput value fieldInvalid field specified for MIN_FIELD: %1Invalid field specified for MIN_FIELD: %1Invalid field specified for MAX_FIELD: %1Invalid field specified for MAX_FIELD: %1Invalid field specified for VALUE_FIELD: %1Invalid field specified for VALUE_FIELD: %1Invalid value for minimum: %1Invalid value for minimum: %1Invalid value for maximum: %1Invalid value for maximum: %1Invalid output value: %1Invalid output value: %1Reclassify by tableReclassify by tableThis algorithm reclassifies a raster band by assigning new class values based on the ranges specified in a fixed table.This algorithm reclassifies a raster band by assigning new class values based on the ranges specified in a fixed table.Reclassification tableReclassification tableFilteredFilteredFilters away vertices based on their %1, returning geometries with only vertex points that have a %1 ≥ the specified minimum value and ≤ the maximum value.
If the minimum value is not specified than only the maximum value is tested, and similarly if the maximum value is not specified than only the minimum value is tested.
Depending on the input geometry attributes and the filters used, the resultant geometries created by this algorithm may no longer be valid.Filters away vertices based on their %1, returning geometries with only vertex points that have a %1 ≥ the specified minimum value and ≤ the maximum value.
If the minimum value is not specified than only the maximum value is tested, and similarly if the maximum value is not specified than only the minimum value is tested.
Depending on the input geometry attributes and the filters used, the resultant geometries created by this algorithm may no longer be valid.MinimumMinimumMinimum valueMinimum valueMaximumMaximumMaximum valueMaximum valueFilter vertices by m valueFilter vertices by m valuefilter,points,vertex,mfilter,points,vertex,mm-valuem-valueFilter vertices by z valueFilter vertices by z valuefilter,points,vertex,zfilter,points,vertex,zz-valuez-valueInvalid value for TABLE: list must contain a multiple of 3 elements (found %1)Invalid value for TABLE: list must contain a multiple of 3 elements (found %1)RangeRangeMinorityMinorityMajorityMajorityVarietyVarietyQ1Q1Q3Q3IQRIQRRename GRASS %1Rename GRASS %1Cannot delete %1Cannot delete %1Cannot rename %1 to %2Cannot rename %1 to %2Recent colorsRecent colorsStandard colorsStandard colorsProject colorsProject colorsDelete ConnectionDelete ConnectionAre you sure you want to delete the connection to %1?Are you sure you want to delete the connection to %1?Delete ObjectDelete ObjectDelete TableDelete TableAre you sure you want to delete [%1].[%2]?Are you sure you want to delete [%1].[%2]?Are you sure you want to truncate [%1].[%2]?
This will delete all data within the table.Are you sure you want to truncate [%1].[%2]?
This will delete all data within the table.Are you sure you want to delete %1.%2?Are you sure you want to delete %1 %2? {1.%2??}Truncate TableTruncate TableAre you sure you want to truncate %1.%2?
This will delete all data within the table.Are you sure you want to truncate %1.%2?
This will delete all data within the table.Refresh Materialized ViewRefresh Materialized ViewAre you sure you want to refresh the materialized view %1.%2?
This will update all data within the table.Are you sure you want to refresh the materialized view %1.%2?
This will update all data within the table.Delete SchemaDelete SchemaSchema '%1' contains objects:
%2
Are you sure you want to delete the schema and all these objects?Schema '%1' contains objects:
%2
Are you sure you want to delete the schema and all these objects?Are you sure you want to delete the schema '%1'?Are you sure you want to delete the schema '%1'?Are you sure you want to delete %1?Are you sure you want to delete %1 %2? {1??}Unable to reproject.Unable to reproject.Cell size must not be zero.Cell size must not be zero.No common intersecting area.No common intersecting area.Unable to open input file: %1Unable to open input file: %1Unable to create output file: %1Unable to create output file: %1Un-named Color SchemeUn-named Color SchemeAccessible Color SchemeAccessible Color SchemeOpen LinkOpen LinkCopy Link AddressCopy Link AddressSend Email To…Send Email To…Copy Email AddressCopy Email AddressCannot open database %1 by driver %2Cannot open database %1 by driver %2Cannot describe table %1Cannot describe table %1GRASS vector map %1 does not have topology. Build topology?GRASS vector map %1 does not have topology. Build topology?Key column '%1' not found in the table '%2'Key column '%1' not found in the table '%2'SecureProtocolsSecureProtocolsTlsV1SslV3TlsV1SslV3TlsV1TlsV1SslV3SslV3SslV2SslV2(Organization not defined)(Organization not defined)System Root CASystem Root CASystem Root AuthoritiesSystem Root AuthoritiesFile CAFile CAAuthorities from FileAuthorities from FileDatabase CADatabase CAAuthorities in DatabaseAuthorities in DatabaseConnection CAConnection CAAuthorities from connectionAuthorities from connectionDefaultDefaultTrustedTrustedUntrustedUntrustedCertificate is valid.Certificate is valid.Root CA rejected the certificate purpose.Root CA rejected the certificate purpose.Certificate is not trusted.Certificate is not trusted.Signature does not match.Signature does not match.Certificate Authority is invalid or not found.Certificate Authority is invalid or not found.Purpose does not match the intended usage.Purpose does not match the intended usage.Certificate is self-signed, and is not found in the list of trusted certificates.Certificate is self-signed, and is not found in the list of trusted certificates.Certificate has been revoked.Certificate has been revoked.Path length from the root CA to this certificate is too long.Path length from the root CA to this certificate is too long.Certificate has expired or is not yet valid.Certificate has expired or is not yet valid.Certificate Authority has expired.Certificate Authority has expired.Validity is unknown.Validity is unknown.SHA1, with EMSA1SHA1, with EMSA1SHA1, with EMSA3SHA1, with EMSA3MD5, with EMSA3MD5, with EMSA3MD2, with EMSA3MD2, with EMSA3RIPEMD160, with EMSA3RIPEMD160, with EMSA3EMSA3, without digestEMSA3, without digestSHA224, with EMSA3SHA224, with EMSA3SHA256, with EMSA3SHA256, with EMSA3SHA384, with EMSA3SHA384, with EMSA3SHA512, with EMSA3SHA512, with EMSA3Unknown (possibly Elliptic Curve)Unknown (possibly Elliptic Curve)Digital SignatureDigital SignatureNon-repudiationNon-repudiationKey EnciphermentKey EnciphermentData EnciphermentData EnciphermentKey AgreementKey AgreementKey Certificate SignKey Certificate SignCRL SignCRL SignEncipher OnlyEncipher OnlyDecipher OnlyDecipher OnlyServer AuthenticationServer AuthenticationClient AuthenticationClient AuthenticationCode SigningCode SigningEmail ProtectionEmail ProtectionIPSec EndpointIPSec EndpointIPSec TunnelIPSec TunnelIPSec UserIPSec UserTime StampingTime StampingOCSP SigningOCSP SigningAny or unspecifiedAny or unspecifiedCertificate AuthorityCertificate AuthorityCertificate IssuerCertificate IssuerTLS/SSL ServerTLS/SSL ServerTLS/SSL Server EVTLS/SSL Server EVTLS/SSL ClientTLS/SSL ClientCRL SigningCRL SigningUndetermined usageUndetermined usageUnable to Get Issuer CertificateUnable to Get Issuer CertificateUnable to Decrypt Certificate SignatureUnable to Decrypt Certificate SignatureUnable to Decode Issuer Public KeyUnable to Decode Issuer Public KeyUnable to Get Local Issuer CertificateUnable to Get Local Issuer CertificateUnable to Verify First CertificateUnable to Verify First CertificateCertificate Signature FailedCertificate Signature FailedCertificate Not Yet ValidCertificate Not Yet ValidCertificate ExpiredCertificate ExpiredInvalid Not Before FieldInvalid Not Before FieldInvalid Not After FieldInvalid Not After FieldSelf-signed CertificateSelf-signed CertificateSelf-signed Certificate In ChainSelf-signed Certificate In ChainCertificate RevokedCertificate RevokedInvalid CA CertificateInvalid CA CertificatePath Length ExceededPath Length ExceededInvalid PurposeInvalid PurposeCertificate UntrustedCertificate UntrustedCertificate RejectedCertificate RejectedSubject Issuer MismatchSubject Issuer MismatchAuthority Issuer Serial Number MismatchAuthority Issuer Serial Number MismatchNo Peer CertificateNo Peer CertificateHost Name MismatchHost Name MismatchUnspecified ErrorUnspecified ErrorCertificate BlacklistedCertificate BlacklistedNo ErrorNo ErrorNo SSL SupportNo SSL SupportClient certificate is NULL.Client certificate is NULL.Client certificate key is NULL.Client certificate key is NULL.Private key does not match client certificate public key.Private key does not match client certificate public key.Authentication ManagerAuthentication ManagerMaster Password <-> KeyChain storage plugin. Store and retrieve your master password in your KeyChainMaster Password <-> KeyChain storage plugin. Store and retrieve your master password in your KeyChainMaster Password <-> Password Manager storage plugin. Store and retrieve your master password in your Password ManagerMaster Password <-> Password Manager storage plugin. Store and retrieve your master password in your Password ManagerMaster Password <-> Wallet/KeyRing storage plugin. Store and retrieve your master password in your Wallet/KeyRingMaster Password <-> Wallet/KeyRing storage plugin. Store and retrieve your master password in your Wallet/KeyRingMaster Password <-> KeyChain storage plugin. Store and retrieve your master password in your Wallet/KeyChain/Password ManagerMaster Password <-> KeyChain storage plugin. Store and retrieve your master password in your Wallet/KeyChain/Password ManagerAuthentication methodAuthentication methodCould not set trust policy for imported certificatesCould not set trust policy for imported certificatesAuthorities ManagerAuthorities ManagerCould not store sort by preferenceCould not store sort by preferenceCould not store default trust policy.Could not store default trust policy.Could not store 'CA file path' in authentication database.Could not store 'CA file path' in authentication database.Could not store 'CA file allow invalids' setting in authentication database.Could not store 'CA file allow invalids' setting in authentication database.Could not set trust policy for imported certificates.Could not set trust policy for imported certificates.Could not remove 'CA file path' from authentication database.Could not remove 'CA file path' from authentication database.Could not remove 'CA file allow invalids' setting from authentication database.Could not remove 'CA file allow invalids' setting from authentication database.Authentication SystemAuthentication SystemDISABLED. Resources authenticating via the system can not be accessedDISABLED. Resources authenticating via the system can not be accessedMaster password already set.Master password already set.Master password not cleared because it is not set.Master password not cleared because it is not set.Master password cleared (NOTE: network connections may be cached).Master password cleared (NOTE: network connections may be cached).Master password FAILED to be cleared.Master password FAILED to be cleared.Master password resetMaster password resetMaster password reset: NO current password hash in databaseMaster password reset: NO current password hash in databaseMaster password FAILED to be resetMaster password FAILED to be reset (database backup: %1) (database backup: %1)Cached authentication configurations for session clearedCached authentication configurations for session clearedRemove ConfigurationsRemove ConfigurationsAre you sure you want to remove ALL authentication configurations?
Operation can NOT be undone!Are you sure you want to remove ALL authentication configurations?
Operation can NOT be undone!Authentication configurations removed.Authentication configurations removed.Authentication configurations FAILED to be removed.Authentication configurations FAILED to be removed.Active authentication database erased.Active authentication database erased.Authentication database FAILED to be erased.Authentication database FAILED to be erased.Delete PasswordDelete PasswordDo you really want to delete the master password from your %1?Do you really want to delete the master password from your %1?Master password was successfully deleted from your %1Master password was successfully deleted from your %1Password helper deletePassword helper deleteMaster password is not set and cannot be stored in your %1.Master password is not set and cannot be stored in your %1.Master password has been successfully stored in your %1.Master password has been successfully stored in your %1.Password helper writePassword helper writeYour %1 will be <b>used from now</b> on to store and retrieve the master password.Your %1 will be <b>used from now</b> on to store and retrieve the master password.Your %1 will <b>not be used anymore</b> to store and retrieve the master password.Your %1 will <b>not be used anymore</b> to store and retrieve the master password.Erase DatabaseErase DatabaseAre you sure you want to ERASE the entire authentication database?
Operation can NOT be undone!
(Current database will be backed up and new one created.)Are you sure you want to ERASE the entire authentication database?
Operation can NOT be undone!
(Current database will be backed up and new one created.) (backup: %1) (backup: %1)RESTART QGISRESTART QGISFile not foundFile not foundCould not store sort by preference.Could not store sort by preference.Authentication IdentitiesAuthentication IdentitiesAuthentication SSL ConfigsAuthentication SSL ConfigsConfiguration loaded from databaseConfiguration loaded from databaseConfiguration not found in databaseConfiguration not found in databaseTrusted Authorities/IssuersTrusted Authorities/IssuersEntry token invalid : '%1'. The token will not be saved to file.Entry token invalid : '%1'. The token will not be saved to file.Project translationProject translationA hidden field will be invisible - the user is not able to see its contents.A hidden field will be invisible - the user is not able to see its contents.VLayerVLayerExpression SorterExpression SorterDisplays a combo box containing values of attributes used for classification.
Only available when the layer uses a categorized symbol renderer.Displays a combo box containing values of attributes used for classification.
Only available when the layer uses a categorized symbol renderer.Error: %1 on line %2, column %3Error: %1 on line %2, column %3WFSWFSunable to convert '%1' element to a valid expression: it is not supported yet or it has invalid argumentsunable to convert '%1' element to a valid expression: it is not supported yet or it has invalid arguments'%1' binary operator not supported.'%1' binary operator not supported.invalid left operand for '%1' binary operatorinvalid left operand for '%1' binary operatorinvalid right operand for '%1' binary operatorinvalid right operand for '%1' binary operatoronly one operand for '%1' binary operatoronly one operand for '%1' binary operatorNo OGC Geometry foundNo OGC Geometry found%1:PropertyName expected, got %2%1:PropertyName expected, got %2%1:Literal expected, got %2%1:Literal expected, got %2'%1' is an invalid or not supported content for %2:Literal'%1' is an invalid or not supported content for %2:Literalinvalid operand for '%1' unary operatorinvalid operand for '%1' unary operatorNode type not supported: %1Node type not supported: %1This use of unary operator not implemented yetThis use of unary operator not implemented yet<BBOX> is currently supported only in form: bbox($geometry, geomFromWKT('…'))<BBOX> is currently supported only in form: bbox($geometry, geomFromWKT('…'))Unary operator %1 not implemented yetUnary operator %1 not implemented yetBinary operator %1 not implemented yetBinary operator %1 not implemented yetNode type not supported in expression translation: %1Node type not supported in expression translation: %1Unary operator '%1' not implemented yetUnary operator '%1' not implemented yetLiteral type not supported: %1Literal type not supported: %1Unable to translate spatial operator: at least one must refer to geometry.Unable to translate spatial operator: at least one must refer to geometry.spatial operator: the other operator must be a geometry constructor functionspatial operator: the other operator must be a geometry constructor functiongeom_from_wkt: argument must be string literalgeom_from_wkt: argument must be string literalgeom_from_gml: argument must be string literalgeom_from_gml: argument must be string literalgeom_from_gml: unable to parse XMLgeom_from_gml: unable to parse XMLspatial operator: unknown geometry constructor functionspatial operator: unknown geometry constructor functionSpecial columns/constants are not supported.Special columns/constants are not supported.%1: Last argument must be string or integer literal%1: Last argument must be string or integer literalFunction %1 should have 1 or 2 argumentsFunction %1 should have 1 or 2 arguments%1: First argument must be string literal%1: First argument must be string literal%1: invalid WKT%1: invalid WKTFunction %1 should have 4 or 5 argumentsFunction %1 should have 4 or 5 arguments%1: Argument %2 must be numeric literal%1: Argument %2 must be numeric literal%1 Argument %2 must be numeric literal%1 Argument %2 must be numeric literalFunction %1 should have 1 argumentFunction %1 should have 1 argument%1: Argument must be string literal%1: Argument must be string literalST_GeomFromGML: unable to parse XMLST_GeomFromGML: unable to parse XMLFunction %1 should have 2 argumentsFunction %1 should have 2 argumentsFunction %1 should have 3 argumentsFunction %1 should have 3 argumentsFunction %1 3rd argument should be a numeric value or a string made of a numeric value followed by a stringFunction %1 3rd argument should be a numeric value or a string made of a numeric value followed by a stringJoins are only supported with WFS 2.0Joins are only supported with WFS 2.0%1:Function expected, got %2%1:Function expected, got %2missing some required sub-elements in %1:PropertyIsBetweenmissing some required sub-elements in %1:PropertyIsBetweensecond|secondslist of words separated by | which reference yearssecond|secondsminute|minuteslist of words separated by | which reference minutesminute|minuteshour|hourslist of words separated by | which reference minutes hourshour|hoursday|dayslist of words separated by | which reference daysday|daysweek|weekswordlist separated by | which reference weeksweek|weeksmonth|monthslist of words separated by | which reference monthsmonth|monthsyear|yearslist of words separated by | which reference yearsyear|yearsMinimum lengthMinimum lengthMaximum lengthMaximum lengthMean lengthMean lengthFunction '%1' is not declared by the WFS serverFunction '%1' is not declared by the WFS serverColumn '%1' references a non existing tableColumn '%1' references a non existing tableColumn '%1' references a non existing fieldColumn '%1' references a non existing field%1 to %2 arguments%1 to %2 arguments1 argument1 argument%1 arguments%1 arguments%1 arguments or more%1 arguments or more1 argument or more1 argument or more0 argument or more0 argument or moreStyle ManagerStyle ManagerTessellateTessellate3d,triangle3d,triangleVector geometryVector geometryTessellatedTessellatedThis algorithm tessellates a polygon geometry layer, dividing the geometries into triangular components.This algorithm tessellates a polygon geometry layer, dividing the geometries into triangular components.The output layer consists of multipolygon geometries for each input feature, with each multipolygon consisting of multiple triangle component polygons.The output layer consists of multipolygon geometries for each input feature, with each multipolygon consisting of multiple triangle component polygons.HeightHeightExtrusionHeightExtrusionHeightAdd autoincremental fieldAdd autoincremental fieldThis algorithm adds a new integer field to a vector layer, with a sequential value for each feature.
This field can be used as a unique ID for features in the layer. The new attribute is not added to the input layer but a new layer is generated instead.
The initial starting value for the incremental series can be specified.
Optionally, grouping fields can be specified. If group fields are present, then the field value will be reset for each combination of these group field values.
The sort order for features may be specified, if so, then the incremental field will respect this sort order.This algorithm adds a new integer field to a vector layer, with a sequential value for each feature.
This field can be used as a unique ID for features in the layer. The new attribute is not added to the input layer but a new layer is generated instead.
The initial starting value for the incremental series can be specified.
Optionally, grouping fields can be specified. If group fields are present, then the field value will be reset for each combination of these group field values.
The sort order for features may be specified, if so, then the incremental field will respect this sort order.add,create,serial,primary,key,unique,fieldsadd,create,serial,primary,key,unique,fieldsVector tableVector tableIncrementedIncrementedField nameField nameStart values atStart values atGroup values byGroup values bySort expressionSort expressionSort ascendingSort ascendingSort nulls firstSort nulls firstAssign projectionAssign projectionassign,set,transform,reproject,crs,srs,warpassign,set,transform,reproject,crs,srs,warpVector generalVector generalAssigned CRSAssigned CRSThis algorithm assigns a new projection to a vector layer. It creates a new layer with the exact same features and geometries as the input one, but assigned to a new CRS. E.g. the geometries are not reprojected, they are just assigned to a different CRS. This algorithm can be used to repair layers which have been assigned an incorrect projection.
Attributes are not modified by this algorithm.This algorithm assigns a new projection to a vector layer. It creates a new layer with the exact same features and geometries as the input one, but assigned to a new CRS. E.g. the geometries are not reprojected, they are just assigned to a different CRS. This algorithm can be used to repair layers which have been assigned an incorrect projection.
Attributes are not modified by this algorithm.BoundaryBoundaryboundary,ring,border,exteriorboundary,ring,border,exteriorReturns the closure of the combinatorial boundary of the input geometries (ie the topological boundary of the geometry). For instance, a polygon geometry will have a boundary consisting of the linestrings for each ring in the polygon. Only valid for polygon or line layers.Returns the closure of the combinatorial boundary of the input geometries (ie the topological boundary of the geometry). For instance, a polygon geometry will have a boundary consisting of the linestrings for each ring in the polygon. Only valid for polygon or line layers.No boundary for feature %1 (possibly a closed linestring?)'No boundary for feature %1 (possibly a closed linestring?)'Bounding boxesBounding boxesbounding,boxes,envelope,rectangle,extentbounding,boxes,envelope,rectangle,extentBoundsBoundsThis algorithm calculates the bounding box (envelope) for each feature in an input layer.This algorithm calculates the bounding box (envelope) for each feature in an input layer.See the 'Minimum bounding geometry' algorithm for a bounding box calculation which covers the whole layer or grouped subsets of features.See the 'Minimum bounding geometry' algorithm for a bounding box calculation which covers the whole layer or grouped subsets of features.BufferBufferbuffer,grow,fixed,variable,distancebuffer,grow,fixed,variable,distanceInput layerInput layerDistanceDistanceBuffer distanceBuffer distanceSegmentsSegmentsEnd cap styleEnd cap styleRoundRoundFlatFlatSquareSquareJoin styleJoin styleMiterMiterBevelBevelMiter limitMiter limitDissolve resultDissolve resultBufferedBufferedThis algorithm computes a buffer area for all the features in an input layer, using a fixed or dynamic distance.
The segments parameter controls the number of line segments to use to approximate a quarter circle when creating rounded offsets.
The end cap style parameter controls how line endings are handled in the buffer.
The join style parameter specifies whether round, miter or beveled joins should be used when offsetting corners in a line.
The miter limit parameter is only applicable for miter join styles, and controls the maximum distance from the offset curve to use when creating a mitered join.This algorithm computes a buffer area for all the features in an input layer, using a fixed or dynamic distance.
The segments parameter controls the number of line segments to use to approximate a quarter circle when creating rounded offsets.
The end cap style parameter controls how line endings are handled in the buffer.
The join style parameter specifies whether round, miter or beveled joins should be used when offsetting corners in a line.
The miter limit parameter is only applicable for miter join styles, and controls the maximum distance from the offset curve to use when creating a mitered join.Could not load source layer for INPUTCould not load source layer for INPUTError calculating buffer for feature %1Error calculating buffer for feature %1ProcessingProcessingCentroidsCentroidscentroid,center,average,point,middlecentroid,center,average,point,middleThis algorithm creates a new point layer, with points representing the centroid of the geometries in an input layer.
The attributes associated to each point in the output layer are the same ones associated to the original features.This algorithm creates a new point layer, with points representing the centroid of the geometries in an input layer.
The attributes associated to each point in the output layer are the same ones associated to the original features.Create point on surface for each partCreate point on surface for each partError calculating centroid for feature %1 part %2: %3Error calculating centroid for feature %1 part %2: %3Error calculating centroid for feature %1: %2Error calculating centroid for feature %1: %2ClipClipclip,intersect,intersection,maskclip,intersect,intersection,maskVector overlayVector overlayOverlay layerOverlay layerThis algorithm clips a vector layer using the features of an additional polygon layer. Only the parts of the features in the Input layer that fall within the polygons of the Overlay layer will be added to the resulting layer.This algorithm clips a vector layer using the features of an additional polygon layer. Only the parts of the features in the Input layer that fall within the polygons of the Overlay layer will be added to the resulting layer.The attributes of the features are not modified, although properties such as area or length of the features will be modified by the clipping operation. If such properties are stored as attributes, those attributes will have to be manually updated.The attributes of the features are not modified, although properties such as area or length of the features will be modified by the clipping operation. If such properties are stored as attributes, those attributes will have to be manually updated.ClippedClippedCould not create the combined clip geometry: %1Could not create the combined clip geometry: %1Convex hullConvex hullconvex,hull,bounds,boundingconvex,hull,bounds,boundingConvex hullsConvex hullsThis algorithm calculates the convex hull for each feature in an input layer.This algorithm calculates the convex hull for each feature in an input layer.See the 'Minimum bounding geometry' algorithm for a convex hull calculation which covers the whole layer or grouped subsets of features.See the 'Minimum bounding geometry' algorithm for a convex hull calculation which covers the whole layer or grouped subsets of features.Cannot calculate convex hull for a single Point feature (try 'Minimum bounding geometry' algorithm instead).Cannot calculate convex hull for a single Point feature (try 'Minimum bounding geometry' algorithm instead).DissolveDissolvedissolve,union,combine,collectdissolve,union,combine,collectDissolve field(s)Dissolve field(s)This algorithm takes a vector layer and combines their features into new features. One or more attributes can be specified to dissolve features belonging to the same class (having the same value for the specified attributes), alternatively all features can be dissolved in a single one.
All output geometries will be converted to multi geometries. In case the input is a polygon layer, common boundaries of adjacent polygons being dissolved will get erased.This algorithm takes a vector layer and combines their features into new features. One or more attributes can be specified to dissolve features belonging to the same class (having the same value for the specified attributes), alternatively all features can be dissolved in a single one.
All output geometries will be converted to multi geometries. In case the input is a polygon layer, common boundaries of adjacent polygons being dissolved will get erased.Unique ID fieldsUnique ID fieldsDissolvedDissolvedCollect geometriesCollect geometriesunion,combine,collect,multipart,parts,singleunion,combine,collect,multipart,parts,singleCollectedCollectedThis algorithm takes a vector layer and collects its geometries into new multipart geometries. One or more attributes can be specified to collect only geometries belonging to the same class (having the same value for the specified attributes), alternatively all geometries can be collected.This algorithm takes a vector layer and collects its geometries into new multipart geometries. One or more attributes can be specified to collect only geometries belonging to the same class (having the same value for the specified attributes), alternatively all geometries can be collected.All output geometries will be converted to multi geometries, even those with just a single part. This algorithm does not dissolve overlapping geometries - they will be collected together without modifying the shape of each geometry part.All output geometries will be converted to multi geometries, even those with just a single part. This algorithm does not dissolve overlapping geometries - they will be collected together without modifying the shape of each geometry part.See the 'Promote to multipart' or 'Aggregate' algorithms for alternative options.See the 'Promote to multipart' or 'Aggregate' algorithms for alternative options.Drop geometriesDrop geometriesremove,drop,delete,geometry,objectsremove,drop,delete,geometry,objectsDropped geometriesDropped geometriesThis algorithm removes any geometries from an input layer and returns a layer containing only the feature attributes.This algorithm removes any geometries from an input layer and returns a layer containing only the feature attributes.Drop M/Z valuesDrop M/Z valuesdrop,set,convert,m,measure,z,25d,3d,valuesdrop,set,convert,m,measure,z,25d,3d,valuesZ/M DroppedZ/M DroppedThis algorithm can remove any measure (M) or Z values from input geometries.This algorithm can remove any measure (M) or Z values from input geometries.Drop M ValuesDrop M ValuesDrop Z ValuesDrop Z ValuesExtentExtentThis algorithm creates a new vector layer that contains a single feature with geometry matching an extent parameter.
It can be used in models to convert an extent into a layer which can be used for other algorithms which require a layer based input.This algorithm creates a new vector layer that contains a single feature with geometry matching an extent parameter.
It can be used in models to convert an extent into a layer which can be used for other algorithms which require a layer based input.Create layer from extentCreate layer from extentextent,layer,polygon,create,newextent,layer,polygon,create,newExtract by expressionExtract by expressionextract,filter,expression,fieldextract,filter,expression,fieldExpressionExpressionMatching featuresMatching featuresNon-matchingNon-matchingThis algorithm creates a new vector layer that only contains matching features from an input layer. The criteria for adding features to the resulting layer is based on a QGIS expression.
For more information about expressions see the <a href ="{qgisdocs}/user_manual/working_with_vector/expression.html">user manual</a>This algorithm creates a new vector layer that only contains matching features from an input layer. The criteria for adding features to the resulting layer is based on a QGIS expression.
For more information about expressions see the <a href ="{qgisdocs}/user_manual/working_with_vector/expression.html">user manual</a>Extract/clip by extentExtract/clip by extentclip,extract,intersect,intersection,mask,extentclip,extract,intersect,intersection,mask,extentClip features to extentClip features to extentExtractedExtractedThis algorithm creates a new vector layer that only contains features which fall within a specified extent. Any features which intersect the extent will be included.
Optionally, feature geometries can also be clipped to the extent. If this option is selected, then the output geometries will automatically be converted to multi geometries to ensure uniform output geometry types.This algorithm creates a new vector layer that only contains features which fall within a specified extent. Any features which intersect the extent will be included.
Optionally, feature geometries can also be clipped to the extent. If this option is selected, then the output geometries will automatically be converted to multi geometries to ensure uniform output geometry types.Where the features (geometric predicate)Where the features (geometric predicate)intersectintersectcontaincontaindisjointdisjointequalequaltouchtouchoverlapoverlapare withinare withincrosscrosscreating new selectioncreating new selectionadding to current selectionadding to current selectionselecting within current selectionselecting within current selectionremoving from current selectionremoving from current selectionSelect features fromSelect features fromBy comparing to the features fromBy comparing to the features fromModify current selection byModify current selection bySelect by locationSelect by locationselect,intersects,intersecting,disjoint,touching,within,contains,overlaps,relationselect,intersects,intersecting,disjoint,touching,within,contains,overlaps,relationThis algorithm creates a selection in a vector layer. The criteria for selecting features is based on the spatial relationship between each feature and the features in an additional layer.This algorithm creates a selection in a vector layer. The criteria for selecting features is based on the spatial relationship between each feature and the features in an additional layer.Extract features fromExtract features fromExtracted (location)Extracted (location)Extract by locationExtract by locationextract,filter,intersects,intersecting,disjoint,touching,within,contains,overlaps,relationextract,filter,intersects,intersecting,disjoint,touching,within,contains,overlaps,relationThis algorithm creates a new vector layer that only contains matching features from an input layer. The criteria for adding features to the resulting layer is defined based on the spatial relationship between each feature and the features in an additional layer.This algorithm creates a new vector layer that only contains matching features from an input layer. The criteria for adding features to the resulting layer is defined based on the spatial relationship between each feature and the features in an additional layer.All files (*.*)All files (*.*)Fix geometriesFix geometriesrepair,invalid,geometry,make,validrepair,invalid,geometry,make,validFixed geometriesFixed geometriesThis algorithm attempts to create a valid representation of a given invalid geometry without losing any of the input vertices. Already-valid geometries are returned without further intervention. Always outputs multi-geometry layer.
NOTE: M values will be dropped from the output.This algorithm attempts to create a valid representation of a given invalid geometry without losing any of the input vertices. Already-valid geometries are returned without further intervention. Always outputs multi-geometry layer.
NOTE: M values will be dropped from the output.makeValid failed for feature %1 makeValid failed for feature %1 Fixing geometry for feature %1 resulted in %2, geometry has been dropped.Fixing geometry for feature %1 resulted in %2, geometry has been dropped.Join attributes by field valueJoin attributes by field valuejoin,connect,attributes,values,fields,tablesjoin,connect,attributes,values,fields,tablesCreate separate feature for each matching feature (one-to-many)Create separate feature for each matching feature (one-to-many)Take attributes of the first matching feature only (one-to-one)Take attributes of the first matching feature only (one-to-one)Table fieldTable fieldInput layer 2Input layer 2Table field 2Table field 2Layer 2 fields to copy (leave empty to copy all fields)Layer 2 fields to copy (leave empty to copy all fields)Join typeJoin typeDiscard records which could not be joinedDiscard records which could not be joinedJoined field prefixJoined field prefixJoined layerJoined layerUnjoinable features from first layerUnjoinable features from first layerNumber of joined features from input tableNumber of joined features from input tableNumber of unjoinable features from input tableNumber of unjoinable features from input tableThis algorithm takes an input vector layer and creates a new vector layer that is an extended version of the input one, with additional attributes in its attribute table.
The additional attributes and their values are taken from a second vector layer. An attribute is selected in each of them to define the join criteria.This algorithm takes an input vector layer and creates a new vector layer that is an extended version of the input one, with additional attributes in its attribute table.
The additional attributes and their values are taken from a second vector layer. An attribute is selected in each of them to define the join criteria.%1 feature(s) from input layer were successfully matched%1 feature(s) from input layer were successfully matched%1 feature(s) from input layer could not be matched%1 feature(s) from input layer could not be matchedInvalid join fieldsInvalid join fieldsJoin by lines (hub lines)Join by lines (hub lines)join,connect,lines,points,hub,spokejoin,connect,lines,points,hub,spokeVector analysisVector analysisHub layerHub layerHub ID fieldHub ID fieldHub layer fields to copy (leave empty to copy all fields)Hub layer fields to copy (leave empty to copy all fields)Spoke layerSpoke layerSpoke ID fieldSpoke ID fieldSpoke layer fields to copy (leave empty to copy all fields)Spoke layer fields to copy (leave empty to copy all fields)Hub linesHub linesThis algorithm creates hub and spoke diagrams by connecting lines from points on the Spoke layer to matching points in the Hub layer.
Determination of which hub goes with each point is based on a match between the Hub ID field on the hub points and the Spoke ID field on the spoke points.
If input layers are not point layers, a point on the surface of the geometries will be taken as the connecting location.This algorithm creates hub and spoke diagrams by connecting lines from points on the Spoke layer to matching points in the Hub layer.
Determination of which hub goes with each point is based on a match between the Hub ID field on the hub points and the Spoke ID field on the spoke points.
If input layers are not point layers, a point on the surface of the geometries will be taken as the connecting location.Same layer given for both hubs and spokesSame layer given for both hubs and spokesInvalid ID fieldInvalid ID fieldLine intersectionsLine intersectionsline,intersectionline,intersectionIntersect layerIntersect layerIntersectionIntersectionThis algorithm extracts the overlapping portions of features in the Input and Overlay layers. Features in the output Intersection layer are assigned the attributes of the overlapping features from both the Input and Overlay layers.This algorithm extracts the overlapping portions of features in the Input and Overlay layers. Features in the output Intersection layer are assigned the attributes of the overlapping features from both the Input and Overlay layers.Overlay fields to keep (leave empty to keep all fields)Overlay fields to keep (leave empty to keep all fields)Input fields to keep (leave empty to keep all fields)Input fields to keep (leave empty to keep all fields)Intersect fields to keep (leave empty to keep all fields)Intersect fields to keep (leave empty to keep all fields)GEOS geoprocessing error: intersection failed.GEOS geoprocessing error: intersection failed.GEOS geoprocessing error: difference failed.GEOS geoprocessing error: difference failed.IntersectionsIntersectionsThis algorithm creates point features where the lines in the Intersect layer intersect the lines in the Input layer.This algorithm creates point features where the lines in the Intersect layer intersect the lines in the Input layer.Mean coordinate(s)Mean coordinate(s)mean,average,coordinatemean,average,coordinateWeight fieldWeight fieldUnique ID fieldUnique ID fieldMean coordinatesMean coordinatesThis algorithm computes a point layer with the center of mass of geometries in an input layer.
An attribute can be specified as containing weights to be applied to each feature when computing the center of mass.
If an attribute is selected in the <Unique ID field> parameter, features will be grouped according to values in this field. Instead of a single point with the center of mass of the whole layer, the output layer will contain a center of mass for the features in each category.This algorithm computes a point layer with the center of mass of geometries in an input layer.
An attribute can be specified as containing weights to be applied to each feature when computing the center of mass.
If an attribute is selected in the <Unique ID field> parameter, features will be grouped according to values in this field. Instead of a single point with the center of mass of the whole layer, the output layer will contain a center of mass for the features in each category.Negative weight value found. Please fix your data and try again.Negative weight value found. Please fix your data and try again.Merge linesMerge linesline,merge,join,partsline,merge,join,partsMergedMergedThis algorithm joins all connected parts of MultiLineString geometries into single LineString geometries.
If any parts of the input MultiLineString geometries are not connected, the resultant geometry will be a MultiLineString containing any lines which could be merged and any non-connected line parts.This algorithm joins all connected parts of MultiLineString geometries into single LineString geometries.
If any parts of the input MultiLineString geometries are not connected, the resultant geometry will be a MultiLineString containing any lines which could be merged and any non-connected line parts.Error merging lines for feature %1Error merging lines for feature %1Merge vector layersMerge vector layersvector,layers,collect,merge,combinevector,layers,collect,merge,combineInput layersInput layersDestination CRSDestination CRSThis algorithm combines multiple vector layers of the same geometry type into a single one.
If attributes tables are different, the attribute table of the resulting layer will contain the attributes from all input layers. New attributes will be added for the original layer name and source.
If any input layers contain Z or M values, then the output layer will also contain these values. Similarly, if any of the input layers are multi-part, the output layer will also be a multi-part layer.
Optionally, the destination coordinate reference system (CRS) for the merged layer can be set. If it is not set, the CRS will be taken from the first input layer. All layers will all be reprojected to match this CRS.This algorithm combines multiple vector layers of the same geometry type into a single one.
If attributes tables are different, the attribute table of the resulting layer will contain the attributes from all input layers. New attributes will be added for the original layer name and source.
If any input layers contain Z or M values, then the output layer will also contain these values. Similarly, if any of the input layers are multi-part, the output layer will also be a multi-part layer.
Optionally, the destination coordinate reference system (CRS) for the merged layer can be set. If it is not set, the CRS will be taken from the first input layer. All layers will all be reprojected to match this CRS.Using specified destination CRS %1Using specified destination CRS %1Error retrieving map layer.Error retrieving map layer.All layers must be vector layers!All layers must be vector layers!Taking destination CRS %1 from layerTaking destination CRS %1 from layerAll layers must have same geometry type! Encountered a %1 layer when expecting a %2 layer.All layers must have same geometry type! Encountered a %1 layer when expecting a %2 layer.Found a layer with M values, upgrading output type to %1Found a layer with M values, upgrading output type to %1Found a layer with Z values, upgrading output type to %1Found a layer with Z values, upgrading output type to %1Found a layer with multiparts, upgrading output type to %1Found a layer with multiparts, upgrading output type to %1Setting output type to %1Setting output type to %1%1 field in layer %2 has different data type than in other layers (%3 instead of %4)%1 field in layer %2 has different data type than in other layers (%3 instead of %4)Packaging layer %1/%2: %3Packaging layer %1/%2: %3Error obtained while merging one or more layers.Error obtained while merging one or more layers.Minimum enclosing circlesMinimum enclosing circlesminimum,circle,ellipse,extent,bounds,boundingminimum,circle,ellipse,extent,bounds,boundingNumber of segments in circlesNumber of segments in circlesThis algorithm calculates the minimum enclosing circle which covers each feature in an input layer.This algorithm calculates the minimum enclosing circle which covers each feature in an input layer.See the 'Minimum bounding geometry' algorithm for a minimal enclosing circle calculation which covers the whole layer or grouped subsets of features.See the 'Minimum bounding geometry' algorithm for a minimal enclosing circle calculation which covers the whole layer or grouped subsets of features.Multipart to singlepartsMultipart to singlepartsmulti,single,multiple,split,dumpmulti,single,multiple,split,dumpSingle partsSingle partsThis algorithm takes a vector layer with multipart geometries and generates a new one in which all geometries contain a single part. Features with multipart geometries are divided in as many different features as parts the geometry contain, and the same attributes are used for each of them.This algorithm takes a vector layer with multipart geometries and generates a new one in which all geometries contain a single part. Features with multipart geometries are divided in as many different features as parts the geometry contain, and the same attributes are used for each of them.Order by expressionOrder by expressionorderby,sort,expression,fieldorderby,sort,expression,fieldOrderedOrderedThis algorithm sorts a vector layer according to an expression. Be careful, it might not work as expected with some providers, the order might not be kept every time.This algorithm sorts a vector layer according to an expression. Be careful, it might not work as expected with some providers, the order might not be kept every time.Oriented minimum bounding boxOriented minimum bounding boxbounding,boxes,envelope,rectangle,extent,oriented,anglebounding,boxes,envelope,rectangle,extent,oriented,angleThis algorithm calculates the minimum area rotated rectangle which covers each feature in an input layer.This algorithm calculates the minimum area rotated rectangle which covers each feature in an input layer.See the 'Minimum bounding geometry' algorithm for a oriented bounding box calculation which covers the whole layer or grouped subsets of features.See the 'Minimum bounding geometry' algorithm for a oriented bounding box calculation which covers the whole layer or grouped subsets of features.Promote to multipartPromote to multipartmulti,single,multiple,convert,force,partsmulti,single,multiple,convert,force,partsMultipartsMultipartsThis algorithm takes a vector layer with singlepart geometries and generates a new one in which all geometries are multipart. Input features which are already multipart features will remain unchanged.This algorithm takes a vector layer with singlepart geometries and generates a new one in which all geometries are multipart. Input features which are already multipart features will remain unchanged.This algorithm can be used to force geometries to multipart types in order to be compatibility with data providers with strict singlepart/multipart compatibility checks.This algorithm can be used to force geometries to multipart types in order to be compatibility with data providers with strict singlepart/multipart compatibility checks.See the 'Collect geometries' or 'Aggregate' algorithms for alternative options.See the 'Collect geometries' or 'Aggregate' algorithms for alternative options.Raster layer unique values reportRaster layer unique values reportcount,area,statisticscount,area,statisticsRaster analysisRaster analysisUpdatedUpdatedBand numberBand numberValue for nodata or non-intersecting verticesValue for nodata or non-intersecting verticesScale factorScale factorTransform error while reprojecting feature {}Transform error while reprojecting feature {}Drape (set z-value from raster)Drape (set z-value from raster)3d,vertex,vertices,elevation,height,sample,dem,update,feature3d,vertex,vertices,elevation,height,sample,dem,update,featureThis algorithm sets the z value of every vertex in the feature geometry to a value sampled from a band within a raster layer.This algorithm sets the z value of every vertex in the feature geometry to a value sampled from a band within a raster layer.The raster values can optionally be scaled by a preset amount.The raster values can optionally be scaled by a preset amount.Sets the z value for vertices to values sampled from a raster layer.Sets the z value for vertices to values sampled from a raster layer.Set m-value from rasterSet m-value from rasterdrape,vertex,vertices,sample,dem,update,feature,measuredrape,vertex,vertices,sample,dem,update,feature,measureThis algorithm sets the m-value for every vertex in the feature geometry to a value sampled from a band within a raster layer.This algorithm sets the m-value for every vertex in the feature geometry to a value sampled from a band within a raster layer.Sets the m-value for vertices to values sampled from a raster layer.Sets the m-value for vertices to values sampled from a raster layer.Unique values reportUnique values reportHTML files (*.html)HTML files (*.html)Unique values tableUnique values tableCRS authority identifierCRS authority identifierWidth in pixelsWidth in pixelsHeight in pixelsHeight in pixelsTotal pixel countTotal pixel countNODATA pixel countNODATA pixel countThis algorithm returns the count and area of each unique value in a given raster layer.This algorithm returns the count and area of each unique value in a given raster layer.Invalid band number for BAND (%1): Valid values for input raster are 1 to %2Invalid band number for BAND (%1): Valid values for input raster are 1 to %2Analyzed fileAnalyzed filebandband<p>%1: %2</p>
<p>%1: %2</p>
<p>%1: %2 (%3)</p>
<p>%1: %2 (%3)</p>
ProjectionProjection<p>%1: %2 (%3 %4)</p>
<p>%1: %2 (%3 %4)</p>
units per pixelunits per pixelPixel countPixel countAreaAreaCleanedCleanedRemove duplicate verticesRemove duplicate verticespoints,valid,overlapping,vertex,nodespoints,valid,overlapping,vertex,nodesThis algorithm removes duplicate vertices from features, wherever removing the vertices does not result in a degenerate geometry.
The tolerance parameter specifies the tolerance for coordinates when determining whether vertices are identical.
By default, z values are not considered when detecting duplicate vertices. E.g. two vertices with the same x and y coordinate but different z values will still be considered duplicate and one will be removed. If the Use Z Value parameter is true, then the z values are also tested and vertices with the same x and y but different z will be maintained.
Note that duplicate vertices are not tested between different parts of a multipart geometry. E.g. a multipoint geometry with overlapping points will not be changed by this method.This algorithm removes duplicate vertices from features, wherever removing the vertices does not result in a degenerate geometry.
The tolerance parameter specifies the tolerance for coordinates when determining whether vertices are identical.
By default, z values are not considered when detecting duplicate vertices. E.g. two vertices with the same x and y coordinate but different z values will still be considered duplicate and one will be removed. If the Use Z Value parameter is true, then the z values are also tested and vertices with the same x and y but different z will be maintained.
Note that duplicate vertices are not tested between different parts of a multipart geometry. E.g. a multipoint geometry with overlapping points will not be changed by this method.ToleranceToleranceTolerance distanceTolerance distanceUse Z ValueUse Z ValueRemove null geometriesRemove null geometriesremove,drop,delete,empty,geometryremove,drop,delete,empty,geometryNon null geometriesNon null geometriesNull geometriesNull geometriesThis algorithm removes any features which do not have a geometry from a vector layer. All other features will be copied unchanged.
Optionally, the features with null geometries can be saved to a separate output.This algorithm removes any features which do not have a geometry from a vector layer. All other features will be copied unchanged.
Optionally, the features with null geometries can be saved to a separate output.Rename layerRename layerchange,layer,name,titlechange,layer,name,titleThis algorithm renames a layer.This algorithm renames a layer.New nameNew nameSelected featuresSelected featuresExtract selected featuresExtract selected featuresselection,save,byselection,save,byThis algorithm creates a new layer with all the selected features in a given vector layer.
If the selected layer has no selected features, the newly created layer will be empty.This algorithm creates a new layer with all the selected features in a given vector layer.
If the selected layer has no selected features, the newly created layer will be empty.SimplifySimplifysimplify,generalize,douglas,peucker,visvalingamsimplify,generalize,douglas,peucker,visvalingamSimplifiedSimplifiedThis algorithm simplifies the geometries in a line or polygon layer. It creates a new layer with the same features as the ones in the input layer, but with geometries containing a lower number of vertices.
The algorithm gives a choice of simplification methods, including distance based (the "Douglas-Peucker" algorithm), area based ("Visvalingam" algorithm) and snapping geometries to a grid.This algorithm simplifies the geometries in a line or polygon layer. It creates a new layer with the same features as the ones in the input layer, but with geometries containing a lower number of vertices.
The algorithm gives a choice of simplification methods, including distance based (the "Douglas-Peucker" algorithm), area based ("Visvalingam" algorithm) and snapping geometries to a grid.Distance (Douglas-Peucker)Distance (Douglas-Peucker)Snap to gridSnap to gridArea (Visvalingam)Area (Visvalingam)Simplification methodSimplification methodSmoothSmoothsmooth,curve,generalize,round,bend,cornerssmooth,curve,generalize,round,bend,cornersSmoothedSmoothedThis algorithm smooths the geometries in a line or polygon layer. It creates a new layer with the same features as the ones in the input layer, but with geometries containing a higher number of vertices and corners in the geometries smoothed out.
The iterations parameter dictates how many smoothing iterations will be applied to each geometry. A higher number of iterations results in smoother geometries with the cost of greater number of nodes in the geometries.
The offset parameter controls how "tightly" the smoothed geometries follow the original geometries. Smaller values results in a tighter fit, and larger values will create a looser fit.
The maximum angle parameter can be used to prevent smoothing of nodes with large angles. Any node where the angle of the segments to either side is larger than this will not be smoothed. For example, setting the maximum angle to 90 degrees or lower would preserve right angles in the geometry.
If input geometries contain Z or M values, these will also be smoothed and the output geometry will retain the same dimensionality as the input geometry.This algorithm smooths the geometries in a line or polygon layer. It creates a new layer with the same features as the ones in the input layer, but with geometries containing a higher number of vertices and corners in the geometries smoothed out.
The iterations parameter dictates how many smoothing iterations will be applied to each geometry. A higher number of iterations results in smoother geometries with the cost of greater number of nodes in the geometries.
The offset parameter controls how "tightly" the smoothed geometries follow the original geometries. Smaller values results in a tighter fit, and larger values will create a looser fit.
The maximum angle parameter can be used to prevent smoothing of nodes with large angles. Any node where the angle of the segments to either side is larger than this will not be smoothed. For example, setting the maximum angle to 90 degrees or lower would preserve right angles in the geometry.
If input geometries contain Z or M values, these will also be smoothed and the output geometry will retain the same dimensionality as the input geometry.IterationsIterationsOffset linesOffset linesoffset,linestringoffset,linestringOffsetOffsetThis algorithm offsets lines by a specified distance. Positive distances will offset lines to the left, and negative distances will offset to the right of lines.
The segments parameter controls the number of line segments to use to approximate a quarter circle when creating rounded offsets.
The join style parameter specifies whether round, miter or beveled joins should be used when offsetting corners in a line.
The miter limit parameter is only applicable for miter join styles, and controls the maximum distance from the offset curve to use when creating a mitered join.This algorithm offsets lines by a specified distance. Positive distances will offset lines to the left, and negative distances will offset to the right of lines.
The segments parameter controls the number of line segments to use to approximate a quarter circle when creating rounded offsets.
The join style parameter specifies whether round, miter or beveled joins should be used when offsetting corners in a line.
The miter limit parameter is only applicable for miter join styles, and controls the maximum distance from the offset curve to use when creating a mitered join.Offsets lines by a specified distance.Offsets lines by a specified distance.Maximum node angle to smoothMaximum node angle to smoothError smoothing geometry %1Error smoothing geometry %1Snap points to gridSnap points to gridsnapped,grid,simplify,round,precisionsnapped,grid,simplify,round,precisionSnappedSnappedThis algorithm modifies the coordinates of geometries in a vector layer, so that all points or vertices are snapped to the closest point of the grid.
If the snapped geometry cannot be calculated (or is totally collapsed) the feature's geometry will be cleared.
Note that snapping to grid may generate an invalid geometry in some corner cases.
Snapping can be performed on the X, Y, Z or M axis. A grid spacing of 0 for any axis will disable snapping for that axis.This algorithm modifies the coordinates of geometries in a vector layer, so that all points or vertices are snapped to the closest point of the grid.
If the snapped geometry cannot be calculated (or is totally collapsed) the feature's geometry will be cleared.
Note that snapping to grid may generate an invalid geometry in some corner cases.
Snapping can be performed on the X, Y, Z or M axis. A grid spacing of 0 for any axis will disable snapping for that axis.X Grid SpacingX Grid SpacingY Grid SpacingY Grid SpacingZ Grid SpacingZ Grid SpacingM Grid SpacingM Grid SpacingError snapping geometry %1Error snapping geometry %1Split with linesSplit with linessplit,cut,linessplit,cut,linesSplit layerSplit layerSplitSplitThis algorithm splits the lines or polygons in one layer using the lines in another layer to define the breaking points. Intersection between geometries in both layers are considered as split points.This algorithm splits the lines or polygons in one layer using the lines in another layer to define the breaking points. Intersection between geometries in both layers are considered as split points.String concatenationString concatenationstring,concatenation,mergestring,concatenation,mergeThis algorithm concatenates two strings together.This algorithm concatenates two strings together.Input 1Input 1Input 2Input 2ConcatenationConcatenationMaximum nodes in partsMaximum nodes in partsSubdivideSubdividesubdivide,segmentize,split,tessellatesubdivide,segmentize,split,tessellateSubdivides the geometry. The returned geometry will be a collection containing subdivided parts from the original geometry, where no part has more then the specified maximum number of nodes.
This is useful for dividing a complex geometry into less complex parts, which are better able to be spatially indexed and faster to perform further operations such as intersects on. The returned geometry parts may not be valid and may contain self-intersections.
Curved geometries will be segmentized before subdivision.Subdivides the geometry. The returned geometry will be a collection containing subdivided parts from the original geometry, where no part has more then the specified maximum number of nodes.
This is useful for dividing a complex geometry into less complex parts, which are better able to be spatially indexed and faster to perform further operations such as intersects on. The returned geometry parts may not be valid and may contain self-intersections.
Curved geometries will be segmentized before subdivision.SubdividedSubdividedError calculating subdivision for feature %1Error calculating subdivision for feature %1TransectTransecttransect,station,lines,extend,transect,station,lines,extend,Length of the transectLength of the transectAngle in degrees from the original line at the verticesAngle in degrees from the original line at the verticesAngle in degreesAngle in degreesSide to create the transectsSide to create the transectsLeftLeftRightRightBothBothThis algorithm creates transects on vertices for (multi)linestring.
This algorithm creates transects on vertices for (multi)linestring.
A transect is a line oriented from an angle (by default perpendicular) to the input polylines (at vertices).A transect is a line oriented from an angle (by default perpendicular) to the input polylines (at vertices).Field(s) from feature(s) are returned in the transect with these new fields:
Field(s) from feature(s) are returned in the transect with these new fields:
- TR_FID: ID of the original feature
- TR_FID: ID of the original feature
- TR_ID: ID of the transect. Each transect have an unique ID
- TR_ID: ID of the transect. Each transect have an unique ID
- TR_SEGMENT: ID of the segment of the linestring
- TR_SEGMENT: ID of the segment of the linestring
- TR_ANGLE: Angle in degrees from the original line at the vertex
- TR_ANGLE: Angle in degrees from the original line at the vertex
- TR_LENGTH: Total length of the transect returned
- TR_LENGTH: Total length of the transect returned
- TR_ORIENT: Side of the transect (only on the left or right of the line, or both side)
- TR_ORIENT: Side of the transect (only on the left or right of the line, or both side)
Target CRSTarget CRSReprojectedReprojectedReproject layerReproject layertransform,reprojection,crs,srs,warptransform,reprojection,crs,srs,warpThis algorithm reprojects a vector layer. It creates a new layer with the same features as the input one, but with geometries reprojected to a new CRS.
Attributes are not modified by this algorithm.This algorithm reprojects a vector layer. It creates a new layer with the same features as the input one, but with geometries reprojected to a new CRS.
Attributes are not modified by this algorithm.TranslateTranslatemove,shift,transform,z,m,values,addmove,shift,transform,z,m,values,addTranslatedTranslatedThis algorithm moves the geometries within a layer, by offsetting them with a specified x and y displacement.This algorithm moves the geometries within a layer, by offsetting them with a specified x and y displacement.Z and M values present in the geometry can also be translated.Z and M values present in the geometry can also be translated.Array of translated featuresArray of translated featurestranslate,parallel,offset,duplicate,grid,spaced,moved,copy,features,objects,step,repeattranslate,parallel,offset,duplicate,grid,spaced,moved,copy,features,objects,step,repeatThis algorithm creates copies of features in a layer, by creating multiple translated versions of each feature. Each copy is incrementally displaced by a preset amount in the x/y/z/m axis.This algorithm creates copies of features in a layer, by creating multiple translated versions of each feature. Each copy is incrementally displaced by a preset amount in the x/y/z/m axis.Creates multiple translated copies of features in a layer.Creates multiple translated copies of features in a layer.Number of features to createNumber of features to createStep distance (x-axis)Step distance (x-axis)Offset distance (x-axis)Offset distance (x-axis)Step distance (y-axis)Step distance (y-axis)Offset distance (y-axis)Offset distance (y-axis)Step distance (z-axis)Step distance (z-axis)Offset distance (z-axis)Offset distance (z-axis)Step distance (m values)Step distance (m values)Offset distance (m values)Offset distance (m values)DWG/DXF importDWG/DXF importNot yet implemented %1Not yet implemented %1SQL statement failed
Database: %1
SQL: %2
Error: %3SQL statement failed
Database: %1
SQL: %2
Error: %3Could not start transaction
Database: %1
Error: %2Could not start transaction
Database: %1
Error: %2Could not commit transaction
Database: %1
Error: %2Could not commit transaction
Database: %1
Error: %2Drawing %1 is unreadableDrawing %1 is unreadableCould not open database [%1]Could not open database [%1]Query for drawing %1 failed.Query for drawing %1 failed.Could not retrieve drawing name from database [%1]Could not retrieve drawing name from database [%1]Recorded last modification date unreadable [%1]Recorded last modification date unreadable [%1]Drawing already uptodate in database.Drawing already uptodate in database.Imported drawingsImported drawingsHeadersHeadersLine typesLine typesLayer listLayer listDimension stylesDimension stylesText stylesText stylesApplication dataApplication dataBLOCK entitiesBLOCK entitiesPOINT entitiesPOINT entitiesLINE entitiesLINE entitiesPOLYLINE entitiesPOLYLINE entitiesTEXT entitiesTEXT entitiesHATCH entitiesHATCH entitiesINSERT entitiesINSERT entitiesCould not load geopackage driverCould not load geopackage driverCreation of datasource failed [%1]Creation of datasource failed [%1]Creation of drawing layer %1 failed [%2]Creation of drawing layer %1 failed [%2]Creation of field definition for %1.%2 failed [%3]Creation of field definition for %1.%2 failed [%3]Creation of field %1.%2 failed [%3]Creation of field %1.%2 failed [%3]Could not update drawing record [%1]Could not update drawing record [%1]Updating database from %1 [%2].Updating database from %1 [%2].File %1 is not a DWG/DXF fileFile %1 is not a DWG/DXF fileNo error.No error.Unknown error.Unknown error.error opening file.error opening file.unsupported version.unsupported version.error reading metadata.error reading metadata.error in file header read process.error in file header read process.error in header vars read process.error in header vars read process.error in object map read process.error in object map read process.error in classes read process.error in classes read process.error in tables read process.error in tables read process.error in block read process.error in block read process.error in entities read process.error in entities read process.error in objects read process.error in objects read process.Could not update comment in drawing record [%1]Could not update comment in drawing record [%1]Could not add %3 %1 [%2]Could not add %3 %1 [%2]header recordheader recorddotted linetypes - dot ignoreddotted linetypes - dot ignoredline typeline typelayerlayerField %1 not foundField %1 not foundLine width defaultLine width defaultdimension styledimension styletext styletext styleCould not create geometry [%1]Could not create geometry [%1]Could not add %2 [%1]Could not add %2 [%1]blockblockpointpointRAY entitiesRAY entitiesXLINE entitiesXLINE entitiesarcarccirclecircleline stringline stringpolygonpolygonsplinesplineKNOT entitiesKNOT entitiesTRACE entitiesTRACE entities3DFACE entities3DFACE entitiesDIMALIGN entitiesDIMALIGN entitiesDIMLINEAR entitiesDIMLINEAR entitiesDIMRADIAL entitiesDIMRADIAL entitiesDIMDIAMETRIC entitiesDIMDIAMETRIC entitiesDIMANGULAR entitiesDIMANGULAR entitiesDIMANGULAR3P entitiesDIMANGULAR3P entitiesDIMORDINAL entitiesDIMORDINAL entitiesLEADER entitiesLEADER entitiesVIEWPORT entitiesVIEWPORT entitiesIMAGE entitiesIMAGE entitiesimage linksimage linkscommentscommentsCould not copy feature of block %2 from layer %1 [Errors: %3]Could not copy feature of block %2 from layer %1 [Errors: %3]Not logging more errorsNot logging more errors%1 write errors during block expansion%1 write errors during block expansion%1 block insertion expanded.%1 block insertion expanded.PagePageDelete style %1 from %2Delete style %1 from %2Delete StyleDelete StyleAre you sure you want to delete the style %1?Are you sure you want to delete the style %1?Paper sizePaper sizestring string Page widthPage widthPage heightPage heightNumber of pagesNumber of pagesSymbol sizeSymbol sizePage numberPage numberPosition (X)Position (X)Position (Y)Position (Y)WidthWidthRotation angleRotation angleTransparencyTransparencyOpacityOpacityBlend modeBlend modeExclude item from exportsExclude item from exportsFrame colorFrame colorBackground colorBackground colorMap rotationMap rotationMap scaleMap scaleExtent minimum XExtent minimum XExtent minimum YExtent minimum YExtent maximum XExtent maximum XExtent maximum YExtent maximum YAtlas marginAtlas marginPicture source (URL)Picture source (URL)Source URLSource URLSVG background colorSVG background colorSVG stroke colorSVG stroke colorSVG stroke widthSVG stroke widthLegend titleLegend titleNumber of columnsNumber of columnsFill colorFill colorSecondary fill colorSecondary fill colorLine colorLine colorLine widthLine widthlist of map layer names separated by | characterslist of map layer names separated by | charactersGrid %1Grid %1No matching recordsNo matching recordsDistribute Items by LeftDistribute Items by LeftDistribute Items by CenterDistribute Items by CenterDistribute Items by RightDistribute Items by RightDistribute Items by TopDistribute Items by TopDistribute Items by Vertical CenterDistribute Items by Vertical CenterDistribute Items by BottomDistribute Items by BottomResize Items to NarrowestResize Items to NarrowestResize Items to WidestResize Items to WidestResize Items to ShortestResize Items to ShortestResize Items to TallestResize Items to TallestResize Items to SquareResize Items to SquareAlign Items to LeftAlign Items to LeftAlign Items to CenterAlign Items to CenterAlign Items to RightAlign Items to RightAlign Items to TopAlign Items to TopAlign Items to Vertical CenterAlign Items to Vertical CenterAlign Items to BottomAlign Items to BottomExporting %1 of %2Exporting %1 of %2Exporting section %1Exporting section %1Cannot write to %1. This file may be open in another application or may be an invalid path.Cannot write to %1. This file may be open in another application or may be an invalid path.Printing %1 of %2Printing %1 of %2Printing section %1Printing section %1Layer %1Layer %1Change Grid ResolutionChange Grid ResolutionChange Grid OffsetChange Grid OffsetA6A6A5A5A4A4A3A3A2A2A1A1A0A0B6B6B5B5B4B4B3B3B2B2B1B1B0B0LegalLegalLetterLetterANSI AANSI AANSI BANSI BANSI CANSI CANSI DANSI DANSI EANSI EArch AArch AArch BArch BArch CArch CArch DArch DArch EArch EArch E1Arch E1Arch E2Arch E2Arch E3Arch E31920×10802012-05-04T1080 {1920×?}1280×8002012-05-04T800 {1280×?}1024×7682012-05-04T768 {1024×?}ReportReportGroup: %1 - %2Group: %1 - %2SectionSectionidentifieridentifierIdentifier element is required.Identifier element is required.languagelanguageLanguage element is required.Language element is required.typetypeType element is required.Type element is required.titletitleTitle element is required.Title element is required.abstractabstractAbstract element is required.Abstract element is required.licenselicenseAt least one license is required.At least one license is required.crscrsA valid CRS element is required.A valid CRS element is required.extentextentA valid CRS element for the spatial extent is required.A valid CRS element for the spatial extent is required.A valid spatial extent is required.A valid spatial extent is required.authorauthorA project author is required.A project author is required.creationcreationThe project creation date/time is required.The project creation date/time is required.contactscontactsAt least one contact is required.At least one contact is required.linkslinksAt least one link is required.At least one link is required.keywordskeywordsKeyword vocabulary cannot be empty.Keyword vocabulary cannot be empty.Keyword list cannot be empty.Keyword list cannot be empty.Contact name cannot be empty.Contact name cannot be empty.Link name cannot be empty.Link name cannot be empty.Link type cannot be empty.Link type cannot be empty.Link url cannot be empty.Link url cannot be empty.modelmodelPrepare algorithm: %1Prepare algorithm: %1Running %1 [%2/%3]Running %1 [%2/%3]Input Parameters:Input Parameters:Error encountered while running %1Error encountered while running %1OK. Execution took %1 s (%2 outputs).OK. Execution took %1 s (%2 outputs).Model processed OK. Executed %1 algorithms total in %2 s.Model processed OK. Executed %1 algorithms total in %2 s.Output '%1' from algorithm '%2'Output '%1' from algorithm '%2'Minimum X of %1Minimum X of %1Minimum Y of %1Minimum Y of %1Maximum X of %1Maximum X of %1Maximum Y of %1Maximum Y of %1The model you are trying to run contains an algorithm that is not available: <i>%1</i>The model you are trying to run contains an algorithm that is not available: <i>%1</i>Incorrect parameter value for %1Incorrect parameter value for %1Duplicate parameter %1 registered for alg %2Duplicate parameter %1 registered for alg %2Duplicate output %1 registered for alg %2Duplicate output %1 registered for alg %2Could not load source layer for %1: no value specified for parameterCould not load source layer for %1: no value specified for parameterCould not load source layer for %1: %2 not foundCould not load source layer for %1: %2 not foundCould not load source layer for %1: invalid valueCould not load source layer for %1: invalid valueCould not create destination layer for %1: no value specified for parameterCould not create destination layer for %1: no value specified for parameterCould not create destination layer for %1: %2Could not create destination layer for %1: %2Could not create destination layer for %1: invalid valueCould not create destination layer for %1: invalid valueEncountered a transform error when reprojecting feature with id %1.Encountered a transform error when reprojecting feature with id %1.Feature (%1) has invalid geometry. Please fix the geometry or change the Processing setting to the "Ignore invalid input features" option.Feature (%1) has invalid geometry. Please fix the geometry or change the Processing setting to the "Ignore invalid input features" option.Feature (%1) has invalid geometry and has been skipped. Please fix the geometry or change the Processing setting to the "Ignore invalid input features" option.Feature (%1) has invalid geometry and has been skipped. Please fix the geometry or change the Processing setting to the "Ignore invalid input features" option.Error transforming extent geometryError transforming extent geometryError transforming point geometryError transforming point geometryPython identifier: ‘%1’Python identifier: ‘%1’Invalid number parameter "%1": min value %2 is >= max value %3!Invalid number parameter "%1": min value %2 is >= max value %3!Minimum value: %1Minimum value: %1Maximum value: %1Maximum value: %1Default value: %1Default value: %1Could not create memory layerCould not create memory layerCould not create layer %1: %2Could not create layer %1: %2<html><body><h2>Algorithm description</h2>
<html><body><h2>Algorithm description</h2>
<h2>Input parameters</h2>
<h2>Input parameters</h2>
<h2>Outputs</h2>
<h2>Outputs</h2>
<p align="right">Algorithm author: %1</p><p align="right">Algorithm author: %1</p><p align="right">Help author: %1</p><p align="right">Help author: %1</p><p align="right">Algorithm version: %1</p><p align="right">Algorithm version: %1</p>Feature could not be written to %1Feature could not be written to %1%1 feature(s) could not be written to %2%1 feature(s) could not be written to %2Features could not be written to %1Features could not be written to %1Unable to zip contentUnable to zip contentUnable to save zip file '%1'Unable to save zip file '%1'Unable to executeUnable to execute%1 '%2': %3%1 '%2': %3Could not create transform to calculate true northCould not create transform to calculate true northCould not transform bounding box to target CRSCould not transform bounding box to target CRSThe source spatial reference system (CRS) is not valid. The coordinates can not be reprojected. The CRS is: %1The source spatial reference system (CRS) is not valid. The coordinates can not be reprojected. The CRS is: %1The destination spatial reference system (CRS) is not valid. The coordinates can not be reprojected. The CRS is: %1The destination spatial reference system (CRS) is not valid. The coordinates can not be reprojected. The CRS is: %1forward transformforward transforminverse transforminverse transform%1 of
%2PROJ: %3 +to %4
Error: %5%1 of
%2PROJ: %3 +to %4
Error: %5Stroke colorStroke colorStroke widthStroke widthPlacement distancePlacement distancePlacement priorityPlacement priorityPlacement z-indexPlacement z-indexDiagram is an obstacleDiagram is an obstacleShow diagramShow diagramAlways show diagramAlways show diagramPie chart start anglePie chart start angleKBKBMBMBGBGBTBTBbytesbytes%1: Not a vector layer.%1: Not a vector layer.Memory layer uri does not contain process or layer id.Memory layer uri does not contain process or layer id.Memory layer from another QGIS instance.Memory layer from another QGIS instance.Cannot get memory layer.Cannot get memory layer.%1: Not a raster layer.%1: Not a raster layer.%1: Not a mesh layer.%1: Not a mesh layer.Font sizeFont sizeBold styleBold styleItalic styleItalic styleDraw underlineDraw underlineText colorText colorDraw strikeoutDraw strikeoutFont familyFont family[<b>family</b>|<b>family[foundry]</b>],<br>e.g. Helvetica or Helvetica [Cronyx][<b>family</b>|<b>family[foundry]</b>],<br>e.g. Helvetica or Helvetica [Cronyx]Font styleFont style[<b>font style name</b>|<b>Ignore</b>],<br>e.g. Bold Condensed or Light Italic[<b>font style name</b>|<b>Ignore</b>],<br>e.g. Bold Condensed or Light ItalicFont size unitsFont size unitsText transparencyText transparencyText opacityText opacityFont caseFont caseLetter spacingLetter spacingWord spacingWord spacingText blend modeText blend modeWrap characterWrap characterAutomatic word wrap line lengthAutomatic word wrap line lengthLine heightLine heightLine alignmentLine alignmentDraw direction symbolDraw direction symbolLeft direction symbolLeft direction symbolRight direction symbolRight direction symbolDirection symbol placementDirection symbol placementReverse direction symbolReverse direction symbolFormat as numberFormat as numberNumber of decimal placesNumber of decimal placesDraw + signDraw + signDraw bufferDraw bufferBuffer unitsBuffer unitsBuffer colorBuffer colorBuffer transparencyBuffer transparencyBuffer opacityBuffer opacityBuffer join styleBuffer join styleBuffer blend modeBuffer blend modeDraw shapeDraw shapeShape typeShape typeShape SVG pathShape SVG pathShape size typeShape size typeShape size (X)Shape size (X)Shape size (Y)Shape size (Y)Shape size unitsShape size unitsShape rotation typeShape rotation typeShape rotationShape rotationShape offsetShape offsetShape offset unitsShape offset unitsShape radiiShape radiiSymbol radii unitsSymbol radii unitsShape transparencyShape transparencyShape opacityShape opacityShape blend modeShape blend modeShape fill colorShape fill colorShape stroke colorShape stroke colorShape stroke widthShape stroke widthShape stroke width unitsShape stroke width unitsShape join styleShape join styleDraw shadowDraw shadowShadow offset angleShadow offset angleShadow offset distanceShadow offset distanceShadow offset unitsShadow offset unitsShadow blur radiusShadow blur radiusShadow blur unitsShadow blur unitsShadow transparencyShadow transparencyShadow opacityShadow opacityShadow scaleShadow scaleShadow colorShadow colorShadow blend modeShadow blend modeCentroid of whole shapeCentroid of whole shapeOffset quadrantOffset quadrantint<br>int<br>Offset unitsOffset unitsLabel distanceLabel distanceLabel distance unitsLabel distance unitsOffset rotationOffset rotationCurved character anglesCurved character anglesdouble coord [<b>in,out</b> as 20.0-60.0,20.0-95.0]double coord [<b>in,out</b> as 20.0-60.0,20.0-95.0]Repeat distanceRepeat distanceRepeat distance unitRepeat distance unitLabel priorityLabel prioritydouble [0.0-10.0]double [0.0-10.0]Feature is a label obstacleFeature is a label obstacleObstacle factorObstacle factorPredefined position orderPredefined position orderComma separated list of placements in order of priority<br>Comma separated list of placements in order of priority<br>Horizontal alignmentHorizontal alignmentVertical alignmentVertical alignmentLabel rotation (deprecated)Label rotation (deprecated)Label rotationLabel rotationScale based visibilityScale based visibilityMinimum scale (denominator)Minimum scale (denominator)Maximum scale (denominator)Maximum scale (denominator)Limit font pixel sizeLimit font pixel sizeMinimum pixel sizeMinimum pixel sizeMaximum pixel sizeMaximum pixel sizeLabel z-indexLabel z-indexShow labelShow labelAlways show labelAlways show labelbool [<b>1</b>=True|<b>0</b>=False]bool [<b>1</b>=True|<b>0</b>=False]int [<= 0 =>]int [<= 0 =>]int [>= 0]int [>= 0]int [>= 1]int [>= 1]double [<= 0.0 =>]double [<= 0.0 =>]double [>= 0.0]double [>= 0.0]double [0.0-1.0]double [0.0-10.0] {0.0-1.0]?}double [0.0-360.0]double [0.0-10.0] {0.0-360.0]?}string of variable lengthstring of variable lengthint [0-100]int [0-100]string [<b>r,g,b,a</b>] as int 0-255 or #<b>RRGGBBAA</b> as hex or <b>color</b> as color's namestring [<b>r,g,b,a</b>] as int 0-255 or #<b>RRGGBBAA</b> as hex or <b>color</b> as color's namestring [<b>r,g,b</b>] as int 0-255 or #<b>RRGGBB</b> as hex or <b>color</b> as color's namestring [<b>r,g,b</b>] as int 0-255 or #<b>RRGGBB</b> as hex or <b>color</b> as color's namedouble coord [<b>X,Y</b>]double coord [<b>X,Y</b>]double size [<b>width,height</b>]double size [<b>width,height</b>]double offset [<b>x,y</b>]double offset [<b>x,y</b>]metersdistancemeterskilometersdistancekilometersfeetdistancefeetyardsdistanceyardsmilesdistancemilesdegreesdistancedegreescentimetersdistancecentimetersmillimetersdistancemillimeters<unknown>distance<unknown>nautical milesdistancenautical milesmdistancemkmdistancekmftdistanceftyddistanceydmidistancemidegdistancedegcmdistancecmmmdistancemmNMdistanceNMsquare metersareasquare meterssquare kilometersareasquare kilometerssquare feetareasquare feetsquare yardsareasquare yardssquare milesareasquare mileshectaresareahectaresacresareaacressquare nautical milesareasquare nautical milessquare degreesareasquare degreessquare millimetersareasquare millimeterssquare centimetersareasquare centimeters<unknown>area<unknown>m²aream²km²areakm²ft²areaft²yd²areayd²mi²areami²haareahaac²areaac²NM²areaNM²deg²areadeg²cm²areacm²mm²areamm²degreesangledegreesradiansangleradiansgonanglegonminutes of arcangleminutes of arcseconds of arcangleseconds of arcturnsangleturns<unknown>angle<unknown>°angle° radangle rad gonangle gon′angle minutes′″angle seconds″ trangle turn trmillimetersrendermillimetersmeters at scalerendermeters at scaleinunit inchinmap unitsrendermap unitspixelsrenderpixelspercentrenderpercentpointsrenderpointsinchesrenderinches<unknown>render<unknown>pxpxmmmmcmcmmmftftptptpicapicapixelspixelsmillimetersmillimeterscentimeterscentimetersmetersmetersinchesinchesfeetfeetpointspointspicaspicasProfile folder doesn't existProfile folder doesn't existqgis.db doesn't exist in the user's profile folderqgis.db doesn't exist in the user's profile folderUnable to open qgis.db for update.Unable to open qgis.db for update.Could not save alias to database: %1Could not save alias to database: %1Geometry error: One or more input features have invalid geometry.Geometry error: One or more input features have invalid geometry.failedfailedadd featuresadd featuresdelete featuresdelete featureschange geometrychange geometrychange attribute valuechange attribute valueadd attributeadd attributedelete attributedelete attributerename attributerename attributecustom transactioncustom transactionparser error: %1parser error: %1evaluation error: %1evaluation error: %1%1 check failed%1 check failedvalue is NULLvalue is NULLvalue is not uniquevalue is not uniqueError zip file does not exist: '%1'Error zip file does not exist: '%1'Error zip filename is emptyError zip filename is emptyError output dir does not exist: '%1'Error output dir does not exist: '%1'Error output dir is not a directory: '%1'Error output dir is not a directory: '%1'Error output dir is not writable: '%1'Error output dir is not writable: '%1'Error reading file: '%1'Error reading file: '%1'Error getting files: '%1'Error getting files: '%1'Error opening zip archive: '%1'Error opening zip archive: '%1'Error input file does not exist: '%1'Error input file does not exist: '%1'Error adding file: '%1'Error adding file: '%1'Error creating data source: '%1'Error creating data source: '%1'Error creating zip archive: '%1'Error creating zip archive: '%1'Symbol nameSymbol nameSymbol fill colorSymbol fill colorSymbol stroke colorSymbol stroke colorSymbol stroke widthSymbol stroke widthSymbol stroke styleSymbol stroke styleSymbol offsetSymbol offsetMarker character(s)Marker character(s)Symbol widthSymbol widthSymbol heightSymbol heightPreserve aspect ratio between width and heightPreserve aspect ratio between width and heightSymbol fill styleSymbol fill styleOutline join styleOutline join styleAngle for line fillsAngle for line fillsGradient typeGradient typeGradient modeGradient modeGradient spreadGradient spreadReference point 1 (X)Reference point 1 (X)Reference point 1 (Y)Reference point 1 (Y)Reference point 2 (X)Reference point 2 (X)Reference point 2 (Y)Reference point 2 (Y)Reference point 1 follows feature centroidReference point 1 follows feature centroidReference point 2 follows feature centroidReference point 2 follows feature centroidBlur radiusBlur radiusInteger between 0 and 18Integer between 0 and 18Distance between linesDistance between linesShade whole shapeShade whole shapeMaximum distance for shapeburst fillMaximum distance for shapeburst fillIgnore rings in featureIgnore rings in featureSymbol file pathSymbol file pathHorizontal distance between markersHorizontal distance between markersVertical distance between markersVertical distance between markersHorizontal displacement between rowsHorizontal displacement between rowsVertical displacement between columnsVertical displacement between columnsCustom dash patternCustom dash pattern[<b><dash>;<space></b>] e.g. '8;2;1;2'[<b><dash>;<space></b>] e.g. '8;2;1;2'Line cap styleLine cap styleMarker placementMarker placementMarker intervalMarker intervalOffset along lineOffset along lineHorizontal anchor pointHorizontal anchor pointVertical anchor pointVertical anchor pointLayer enabledLayer enabledArrow line widthArrow line widthArrow line start widthArrow line start widthArrow head lengthArrow head lengthArrow head thicknessArrow head thicknessArrow head typeArrow head typeArrow typeArrow typeRoot pathRoot pathstring of variable length representing root path to attachmentstring of variable length representing root path to attachmentDocument viewer contentDocument viewer contentstringstringKey/Value fieldKey/Value fieldList fieldList fieldArcGIS Feature ServerArcGIS Feature ServerArcGIS Map ServerArcGIS Map ServerDB2DB2Delimited TextDelimited TextGeoNodeGeoNodeDelete %1…Delete %1…Delete GeoPackageDelete GeoPackageAre you sure you want to delete '%1'?Are you sure you want to delete '%1'?The GeoPackage '%1' cannot be deleted because it is in the current project as '%2', remove it from the project and retry.The GeoPackage '%1' cannot be deleted because it is in the current project as '%2', remove it from the project and retry.Delete LayerDelete LayerThe layer <b>%1</b> exists in the current project <b>%2</b>, do you want to remove it from the project and delete it?The layer <b>%1</b> exists in the current project <b>%2</b>, do you want to remove it from the project and delete it?Are you sure you want to delete layer <b>%1</b> from GeoPackage?Are you sure you want to delete layer <b>%1</b> from GeoPackage?The layer <b>%1</b> cannot be deleted because this feature is not yet implemented for this kind of layers.The layer <b>%1</b> cannot be deleted because this feature is not yet implemented for this kind of layers.Failed to open source layer %1! See the OGR panel in the message logs for details.
Failed to open source layer %1! See the OGR panel in the message logs for details.
Failed to import layer %1! See the OGR panel in the message logs for details.
Failed to import layer %1! See the OGR panel in the message logs for details.
Delete FileDelete FileDelete Layer “%1”…Delete Layer “%1”…Are you sure you want to delete layer '%1' from datasource?Are you sure you want to delete layer '%1' from datasource?Delete %1 “%2”…Delete %1 “%2”…Delete %1Delete %1The %1 '%2' cannot be deleted because it is in the current project as '%3', remove it from the project and retry.The %1 '%2' cannot be deleted because it is in the current project as '%3', remove it from the project and retry.Delete File “%1”…Delete File “%1”…Are you sure you want to delete file '%1'?Are you sure you want to delete file '%1'?The layer '%1' cannot be deleted because it is in the current project as '%2', remove it from the project and retry.The layer '%1' cannot be deleted because it is in the current project as '%2', remove it from the project and retry.Virtual LayerVirtual LayerAdd Virtual LayerAdd Virtual LayerWCSWCSQUERY_LAYERS parameter is required for GetFeatureInfoQUERY_LAYERS parameter is required for GetFeatureInfoLayer '%1' not foundLayer '%1' not foundLayer '%1' is not queryableLayer '%1' is not queryableAdd unique value index fieldAdd unique value index fieldcategorize,categories,category,reclassify,classes,createcategorize,categories,category,reclassify,classes,createClass fieldClass fieldOutput field nameOutput field nameLayer with index fieldLayer with index fieldClass summaryClass summaryThis algorithm takes a vector layer and an attribute and adds a new numeric field. Values in this field correspond to values in the specified attribute, so features with the same value for the attribute will have the same value in the new numeric field. This creates a numeric equivalent of the specified attribute, which defines the same classes.
The new attribute is not added to the input layer but a new layer is generated instead.
Optionally, a separate table can be output which contains a summary of the class field values mapped to the new unique numeric value.This algorithm takes a vector layer and an attribute and adds a new numeric field. Values in this field correspond to values in the specified attribute, so features with the same value for the attribute will have the same value in the new numeric field. This creates a numeric equivalent of the specified attribute, which defines the same classes.
The new attribute is not added to the input layer but a new layer is generated instead.
Optionally, a separate table can be output which contains a summary of the class field values mapped to the new unique numeric value.Invalid field name %1Invalid field name %1Extract verticesExtract verticespoints,vertex,nodespoints,vertex,nodesThis algorithm takes a line or polygon layer and generates a point layer with points representing the vertices in the input lines or polygons. The attributes associated to each point are the same ones associated to the line or polygon that the point belongs to.This algorithm takes a line or polygon layer and generates a point layer with points representing the vertices in the input lines or polygons. The attributes associated to each point are the same ones associated to the line or polygon that the point belongs to.Additional fields are added to the point indicating the vertex index (beginning at 0), the vertex’s part and its index within the part (as well as its ring for polygons), distance along original geometry and bisector angle of vertex for original geometry.Additional fields are added to the point indicating the vertex index (beginning at 0), the vertex’s part and its index within the part (as well as its ring for polygons), distance along original geometry and bisector angle of vertex for original geometry.VerticesVerticesHelp location is not configured!Help location is not configured!QGIS HelpQGIS HelpTrying to open help using key '%1'. Full URI is '%2'…Trying to open help using key '%1'. Full URI is '%2'…geometry's coordinates are too close to each other and simplification failed - skippinggeometry's coordinates are too close to each other and simplification failed - skippingpolygon rings self-intersect or intersect each other - skippingpolygon rings self-intersect or intersect each other - skippingTriangulation failed. Skipping polygon…Triangulation failed. Skipping polygon…3D3DMissing Relation in configurationMissing Relation in configurationInvalid relationInvalid relationrepresentValue() with inconsistent layer parameter w.r.t relation referencingLayerrepresentValue() with inconsistent layer parameter w.r.t relation referencingLayerrepresentValue() with inconsistent fieldIndex parameter w.r.t relation referencingFieldIdxrepresentValue() with inconsistent fieldIndex parameter w.r.t relation referencingFieldIdxCannot find referenced layerCannot find referenced layerTransform error caught: %1Transform error caught: %1%1 bad layers dismissed:%1 bad layers dismissed: * %1 * %1Multi-ring buffer (constant distance)Multi-ring buffer (constant distance)buffer,grow,multiple,rings,distance,donutbuffer,grow,multiple,rings,distance,donutThis algorithm computes multi-ring ('donuts') buffer for all the features in an input layer, using a fixed or dynamic distance and rings number.This algorithm computes multi-ring ('donuts') buffer for all the features in an input layer, using a fixed or dynamic distance and rings number.Number of ringsNumber of ringsDistance between ringsDistance between ringsPoint on surfacePoint on surfacecentroid,inside,withincentroid,inside,withinPointPointReturns a point guaranteed to lie on the surface of a geometry.Returns a point guaranteed to lie on the surface of a geometry.Error calculating point on surface for feature %1 part %2: %3Error calculating point on surface for feature %1 part %2: %3Error calculating point on surface for feature %1: %2Error calculating point on surface for feature %1: %2RotateRotaterotate,around,center,pointrotate,around,center,pointRotatedRotatedThis algorithm rotates feature geometries, by the specified angle clockwiseThis algorithm rotates feature geometries, by the specified angle clockwiseOptionally, the rotation can occur around a preset point. If not set the rotation occurs around each feature's centroid.Optionally, the rotation can occur around a preset point. If not set the rotation occurs around each feature's centroid.Rotation (degrees clockwise)Rotation (degrees clockwise)Rotation anchor pointRotation anchor pointCould not transform anchor point to destination CRSCould not transform anchor point to destination CRSCould not calculate centroid for feature %1: %2Could not calculate centroid for feature %1: %2Segmentize by maximum distanceSegmentize by maximum distancestraighten,linearize,densify,curves,curved,circularstraighten,linearize,densify,curves,curved,circularSegmentizedSegmentizedThis algorithm segmentizes a geometry by converting curved sections to linear sections.
The segmentization is performed by specifying the maximum allowed offset distance between the originalcurve and the segmentized representation.
Non-curved geometries will be retained without change.This algorithm segmentizes a geometry by converting curved sections to linear sections.
The segmentization is performed by specifying the maximum allowed offset distance between the originalcurve and the segmentized representation.
Non-curved geometries will be retained without change.Maximum offset distanceMaximum offset distanceSegmentize by maximum angleSegmentize by maximum anglestraighten,linearize,densify,curves,curved,circular,anglestraighten,linearize,densify,curves,curved,circular,angleThis algorithm segmentizes a geometry by converting curved sections to linear sections.
The segmentization is performed by specifying the maximum allowed radius angle between vertices on the straightened geometry (e.g the angle of the arc created from the original arc center to consecutive output vertices on the linearized geometry).
Non-curved geometries will be retained without change.This algorithm segmentizes a geometry by converting curved sections to linear sections.
The segmentization is performed by specifying the maximum allowed radius angle between vertices on the straightened geometry (e.g the angle of the arc created from the original arc center to consecutive output vertices on the linearized geometry).
Non-curved geometries will be retained without change.Maximum angle between vertices (degrees)Maximum angle between vertices (degrees)Edit form configEdit form configeVis Event Id TooleVis Event Id ToolThis tool only supports vector data.This tool only supports vector data.No active layers found.No active layers found.Map LayersMap LayersMap themeMap themeTable source layerTable source layerDelete holesDelete holesremove,delete,drop,holes,rings,fillremove,delete,drop,holes,rings,fillThis algorithm takes a polygon layer and removes holes in polygons. It creates a new vector layer in which polygons with holes have been replaced by polygons with only their external ring. Attributes are not modified.
An optional minimum area parameter allows removing only holes which are smaller than a specified area threshold. Leaving this parameter as 0.0 results in all holes being removed.This algorithm takes a polygon layer and removes holes in polygons. It creates a new vector layer in which polygons with holes have been replaced by polygons with only their external ring. Attributes are not modified.
An optional minimum area parameter allows removing only holes which are smaller than a specified area threshold. Leaving this parameter as 0.0 results in all holes being removed.Remove holes with area less thanRemove holes with area less thanImport geotagged photosImport geotagged photosexif,metadata,gps,jpeg,jpgexif,metadata,gps,jpeg,jpgVector creationVector creationInput folderInput folderScan recursivelyScan recursivelyPhotosPhotosInvalid photos tableInvalid photos tableCreates a point layer corresponding to the geotagged locations from JPEG images from a source folder. Optionally the folder can be recursively scanned.
The point layer will contain a single PointZ feature per input file from which the geotags could be read. Any altitude information from the geotags will be used to set the point's Z value.
Optionally, a table of unreadable or non-geotagged photos can also be created.Creates a point layer corresponding to the geotagged locations from JPEG images from a source folder. Optionally the folder can be recursively scanned.
The point layer will contain a single PointZ feature per input file from which the geotags could be read. Any altitude information from the geotags will be used to set the point's Z value.
Optionally, a table of unreadable or non-geotagged photos can also be created.Directory %1 does not exist!Directory %1 does not exist!Could not open %1Could not open %1Could not retrieve geotag for %1Could not retrieve geotag for %1No metadata found in %1No metadata found in %1Insert ExpressionInsert ExpressionExplode linesExplode linessegments,partssegments,partsThis algorithm takes a lines layer and creates a new one in which each line is replaced by a set of lines representing the segments in the original line. Each line in the resulting layer contains only a start and an end point, with no intermediate nodes between them.
If the input layer consists of CircularStrings or CompoundCurves, the output layer will be of the same type and contain only single curve segments.This algorithm takes a lines layer and creates a new one in which each line is replaced by a set of lines representing the segments in the original line. Each line in the resulting layer contains only a start and an end point, with no intermediate nodes between them.
If the input layer consists of CircularStrings or CompoundCurves, the output layer will be of the same type and contain only single curve segments.ExplodedExplodedFeature FilterFeature Filterfilter,proxy,redirect,routefilter,proxy,redirect,routeThis algorithm filters features from the input layer and redirects them to one or several outputs.This algorithm filters features from the input layer and redirects them to one or several outputs.Swap X and Y coordinatesSwap X and Y coordinatesinvert,flip,swap,latitude,longitudeinvert,flip,swap,latitude,longitudeSwappedSwappedThis algorithm swaps the X and Y coordinate values in input geometries. It can be used to repair geometries which have accidentally had their latitude and longitude values reversed.This algorithm swaps the X and Y coordinate values in input geometries. It can be used to repair geometries which have accidentally had their latitude and longitude values reversed.Invalid URI for PostgreSQL provider: Invalid URI for PostgreSQL provider: Could not connect to the database: Could not connect to the database: Table qgis_projects does not exist or it is not accessible.Table qgis_projects does not exist or it is not accessible.The project '%1' does not exist in schema '%2'.The project '%1' does not exist in schema '%2'.Unable to save project. It's not possible to create the destination table on the database. Maybe this is due to database permissions (user=%1). Please contact your database admin.Unable to save project. It's not possible to create the destination table on the database. Maybe this is due to database permissions (user=%1). Please contact your database admin.Unable to insert or update project (project=%1) in the destination table on the database. Maybe this is due to table permissions (user=%2). Please contact your database admin.Unable to insert or update project (project=%1) in the destination table on the database. Maybe this is due to table permissions (user=%2). Please contact your database admin.DifferenceDifferenceThis algorithm extracts features from the Input layer that fall outside, or partially overlap, features in the Overlay layer. Input layer features that partially overlap feature(s) in the Overlay layer are split along those features' boundary and only the portions outside the Overlay layer features are retained.This algorithm extracts features from the Input layer that fall outside, or partially overlap, features in the Overlay layer. Input layer features that partially overlap feature(s) in the Overlay layer are split along those features' boundary and only the portions outside the Overlay layer features are retained.Attributes are not modified, although properties such as area or length of the features will be modified by the difference operation. If such properties are stored as attributes, those attributes will have to be manually updated.Attributes are not modified, although properties such as area or length of the features will be modified by the difference operation. If such properties are stored as attributes, those attributes will have to be manually updated.Symmetrical differenceSymmetrical differenceThis algorithm extracts the portions of features from both the Input and Overlay layers that do not overlap. Overlapping areas between the two layers are removed. The attribute table of the Symmetrical Difference layer contains original attributes from both the Input and Difference layers.This algorithm extracts the portions of features from both the Input and Overlay layers that do not overlap. Overlapping areas between the two layers are removed. The attribute table of the Symmetrical Difference layer contains original attributes from both the Input and Difference layers.Tapered buffersTapered buffersvariable,distance,length,line,buffervariable,distance,length,line,bufferThis algorithm creates tapered buffers along line geometries, using a specified start and end buffer diameter corresponding to the buffer diameter at the start and end of the linestrings.This algorithm creates tapered buffers along line geometries, using a specified start and end buffer diameter corresponding to the buffer diameter at the start and end of the linestrings.Start widthStart widthEnd widthEnd widthError buffering geometry %1: %2Error buffering geometry %1: %2Variable width buffer (by m-value)Variable width buffer (by m-value)This algorithm creates variable width buffers along lines, using the m-value of the line geometries as the diameter of the buffer at each vertex.This algorithm creates variable width buffers along lines, using the m-value of the line geometries as the diameter of the buffer at each vertex.UnionUnionThis algorithm checks overlaps between features within the Input layer and creates separate features for overlapping and non-overlapping parts. The area of overlap will create as many identical overlapping features as there are features that participate in that overlap.This algorithm checks overlaps between features within the Input layer and creates separate features for overlapping and non-overlapping parts. The area of overlap will create as many identical overlapping features as there are features that participate in that overlap.An Overlay layer can also be used, in which case features from each layer are split at their overlap with features from the other one, creating a layer containing all the portions from both Input and Overlay layers. The attribute table of the Union layer is filled with attribute values from the respective original layer for non-overlapping features, and attribute values from both layers for overlapping features.An Overlay layer can also be used, in which case features from each layer are split at their overlap with features from the other one, creating a layer containing all the portions from both Input and Overlay layers. The attribute table of the Union layer is filled with attribute values from the respective original layer for non-overlapping features, and attribute values from both layers for overlapping features.Create wedge buffersCreate wedge buffersarc,segment,circular,circle,slicearc,segment,circular,circle,sliceBuffersBuffersThis algorithm creates wedge shaped buffers from input points.
The azimuth parameter gives the angle (in degrees) for the middle of the wedge to point. The buffer width (in degrees) is specified by the width parameter. Note that the wedge will extend to half of the angular width either side of the azimuth direction.
The outer radius of the buffer is specified via outer radius, and optionally an inner radius can also be specified.
The native output from this algorithm are CurvePolygon geometries, but these may be automatically segmentized to Polygons depending on the output format.This algorithm creates wedge shaped buffers from input points.
The azimuth parameter gives the angle (in degrees) for the middle of the wedge to point. The buffer width (in degrees) is specified by the width parameter. Note that the wedge will extend to half of the angular width either side of the azimuth direction.
The outer radius of the buffer is specified via outer radius, and optionally an inner radius can also be specified.
The native output from this algorithm are CurvePolygon geometries, but these may be automatically segmentized to Polygons depending on the output format.Azimuth (degrees from North)Azimuth (degrees from North)Wedge width (in degrees)Wedge width (in degrees)Outer radiusOuter radiusInner radiusInner radiusZonal histogramZonal histogramraster,unique,values,count,area,statisticsraster,unique,values,count,area,statisticsRaster layerRaster layerVector layer containing zonesVector layer containing zonesOutput column prefixOutput column prefixOutput zonesOutput zonesThis algorithm appends fields representing counts of each unique value from a raster layer contained within zones defined as polygons.This algorithm appends fields representing counts of each unique value from a raster layer contained within zones defined as polygons.a|an|and|as|at|but|by|en|for|if|in|nor|of|on|or|per|s|the|to|vs.|vs|viaa|an|and|as|at|but|by|en|for|if|in|nor|of|on|or|per|s|the|to|vs.|vs|via.|:.|:Reset to DefaultsReset to Defaultsstr: layer IDstr: layer IDstr: layer namestr: layer namestr: layer sourcestr: layer sourcestr: CRS auth ID (e.g. 'EPSG:3111')str: CRS auth ID (e.g. 'EPSG:3111')str: CRS PROJ4 (e.g. 'PROJ4:...')str: CRS PROJ4 (e.g. 'PROJ4:...')str: CRS WKT (e.g. 'WKT:...')str: CRS WKT (e.g. 'WKT:...')str: layer ID. CRS of layer is used.str: layer ID. CRS of layer is used.str: layer name. CRS of layer is used.str: layer name. CRS of layer is used.str: layer source. CRS of layer is used.str: layer source. CRS of layer is used.QgsCoordinateReferenceSystemQgsCoordinateReferenceSystemQgsMapLayer: CRS of layer is usedQgsMapLayer: CRS of layer is usedQgsProcessingFeatureSourceDefinition: CRS of source is usedQgsProcessingFeatureSourceDefinition: CRS of source is usedlist[float]: list of 2 float valueslist[float]: list of 2 float valueslist[str]: list of strings representing floatslist[str]: list of strings representing floatsstr: as two comma delimited floats, e.g. '1,10'str: as two comma delimited floats, e.g. '1,10'str: as an 'x,y' string, e.g. '1.5,10.1'str: as an 'x,y' string, e.g. '1.5,10.1'str: as string representation of int, e.g. '1'str: as string representation of int, e.g. '1'str: as comma delimited list of x min, x max, y min, y max. E.g. '4,10,101,105'str: as comma delimited list of x min, x max, y min, y max. E.g. '4,10,101,105'str: layer ID. Extent of layer is used.str: layer ID. Extent of layer is used.str: layer name. Extent of layer is used.str: layer name. Extent of layer is used.str: layer source. Extent of layer is used.str: layer source. Extent of layer is used.QgsMapLayer: Extent of layer is usedQgsMapLayer: Extent of layer is usedQgsProcessingFeatureSourceDefinition: Extent of source is usedQgsProcessingFeatureSourceDefinition: Extent of source is usedstr: as comma delimited list of valuesstr: as comma delimited list of valueslist[str]: list of layer IDslist[str]: list of layer IDslist[str]: list of layer nameslist[str]: list of layer nameslist[str]: list of layer sourceslist[str]: list of layer sourcesstr: destination vector file, e.g. 'd:/test.shp'str: destination vector file, e.g. 'd:/test.shp'str: 'memory:' to store result in temporary memory layerstr: 'memory:' to store result in temporary memory layerstr: using vector provider ID prefix and destination URI, e.g. 'postgres:...' to store result in PostGIS tablestr: using vector provider ID prefix and destination URI, e.g. 'postgres:...' to store result in PostGIS tableUsing classes:Using classes:Warning: Class %1 (%2) overlaps with class %3 (%4)Warning: Class %1 (%2) overlaps with class %3 (%4)K-means clusteringK-means clusteringclustering,clusters,kmeans,pointsclustering,clusters,kmeans,pointsNumber of clustersNumber of clustersCluster field nameCluster field nameDBSCAN clusteringDBSCAN clusteringClusters point features using a density based scan algorithm.Clusters point features using a density based scan algorithm.clustering,clusters,density,based,pointsclustering,clusters,density,based,pointsMinimum cluster sizeMinimum cluster sizeMaximum distance between clustered pointsMaximum distance between clustered pointsTreat border points as noise (DBSCAN*)Treat border points as noise (DBSCAN*)ClustersClustersClusters point features based on a 2D implementation of Density-based spatial clustering of applications with noise (DBSCAN) algorithm.
The algorithm requires two parameters, a minimum cluster size (“minPts”), and the maximum distance allowed between clustered points (“eps”).Clusters point features based on a 2D implementation of Density-based spatial clustering of applications with noise (DBSCAN) algorithm.
The algorithm requires two parameters, a minimum cluster size (“minPts”), and the maximum distance allowed between clustered points (“eps”).Building spatial indexBuilding spatial indexAnalysing clustersAnalysing clustersFeature %1 is a %2 feature, not a point.Feature %1 is a %2 feature, not a point.Calculates the 2D distance based k-means cluster number for each input feature.
If input geometries are lines or polygons, the clustering is based on the centroid of the feature.Calculates the 2D distance based k-means cluster number for each input feature.
If input geometries are lines or polygons, the clustering is based on the centroid of the feature.Collecting input pointsCollecting input pointsNumber of geometries is less than the number of clusters requested, not all clusters will get dataNumber of geometries is less than the number of clusters requested, not all clusters will get dataCalculating clustersCalculating clustersThere are at least %1 duplicate inputs, the number of output clusters may be less than was requestedThere are at least %1 duplicate inputs, the number of output clusters may be less than was requestedClustering did not converge after %1 iterationsClustering did not converge after %1 iterationsClustering converged after %1 iterationsClustering converged after %1 iterationsRaster pixels to polygonsRaster pixels to polygonsvectorize,polygonize,raster,convert,pixelsvectorize,polygonize,raster,convert,pixelsThis algorithm converts a raster layer to a vector layer, by creating polygon features for each individual pixel's extent in the raster layer.
Any nodata pixels are skipped in the output.This algorithm converts a raster layer to a vector layer, by creating polygon features for each individual pixel's extent in the raster layer.
Any nodata pixels are skipped in the output.Creates a vector layer of polygons corresponding to each pixel in a raster layer.Creates a vector layer of polygons corresponding to each pixel in a raster layer.Vector polygonsVector polygonsRaster pixels to pointsRaster pixels to pointsvectorize,polygonize,raster,convert,pixels,centersvectorize,polygonize,raster,convert,pixels,centersThis algorithm converts a raster layer to a vector layer, by creating point features for each individual pixel's center in the raster layer.
Any nodata pixels are skipped in the output.This algorithm converts a raster layer to a vector layer, by creating point features for each individual pixel's center in the raster layer.
Any nodata pixels are skipped in the output.Creates a vector layer of points corresponding to each pixel in a raster layer.Creates a vector layer of points corresponding to each pixel in a raster layer.Vector pointsVector pointsMap CanvasMap CanvasExtend linesExtend lineslinestring,continue,grow,extrapolatelinestring,continue,grow,extrapolateExtendedExtendedThis algorithm extends line geometries by a specified amount at the start and end of the line. Lines are extended using the bearing of the first and last segment in the line.This algorithm extends line geometries by a specified amount at the start and end of the line. Lines are extended using the bearing of the first and last segment in the line.Extends LineString geometries by extrapolating the start and end segments.Extends LineString geometries by extrapolating the start and end segments.Start distanceStart distanceEnd distanceEnd distanceError calculating extended lineError calculating extended lineReverse line directionReverse line directionswap,reverse,switch,flip,linestring,orientationswap,reverse,switch,flip,linestring,orientationReversedReversedThis algorithm reverses the direction of curve or LineString geometries.This algorithm reverses the direction of curve or LineString geometries.Reverses the direction of curve or LineString geometries.Reverses the direction of curve or LineString geometries.Error reversing lineError reversing lineAlgorithm ID: ‘%1’Algorithm ID: ‘%1’MeshMeshNetwork analysisNetwork analysisVector layer representing networkVector layer representing networkPath type to calculatePath type to calculateShortestShortestFastestFastestDirection fieldDirection fieldValue for forward directionValue for forward directionValue for backward directionValue for backward directionValue for both directionsValue for both directionsDefault directionDefault directionForward directionForward directionBackward directionBackward directionBoth directionsBoth directionsSpeed fieldSpeed fieldDefault speed (km/h)Default speed (km/h)Topology toleranceTopology toleranceLoading points…Loading points…Array of offset (parallel) linesArray of offset (parallel) linesoffset,parallel,duplicate,create,spaced,copy,features,objects,step,repeatoffset,parallel,duplicate,create,spaced,copy,features,objects,step,repeatThis algorithm creates copies of line features in a layer, by creating multiple offset versions of each feature. Each copy is offset by a preset distance.This algorithm creates copies of line features in a layer, by creating multiple offset versions of each feature. Each copy is offset by a preset distance.Creates multiple offset copies of lines from a layer.Creates multiple offset copies of lines from a layer.Offset step distanceOffset step distanceStep distanceStep distanceShortest path (layer to point)Shortest path (layer to point)network,path,shortest,fastestnetwork,path,shortest,fastestThis algorithm computes optimal (shortest or fastest) route from multiple start points defined by vector layer and given end point.This algorithm computes optimal (shortest or fastest) route from multiple start points defined by vector layer and given end point.Vector layer with start pointsVector layer with start pointsEnd pointEnd pointShortest pathShortest pathBuilding graph…Building graph…Calculating shortest paths…Calculating shortest paths…There is no route from start point (%1) to end point (%2).There is no route from start point (%1) to end point (%2).Shortest path (point to layer)Shortest path (point to layer)This algorithm computes optimal (shortest or fastest) route between given start point and multiple end points defined by point vector layer.This algorithm computes optimal (shortest or fastest) route between given start point and multiple end points defined by point vector layer.Start pointStart pointVector layer with end pointsVector layer with end pointsShortest path (point to point)Shortest path (point to point)This algorithm computes optimal (shortest or fastest) route between given start and end points.This algorithm computes optimal (shortest or fastest) route between given start and end points.Travel costTravel costCalculating shortest path…Calculating shortest path…There is no route from start point to end point.There is no route from start point to end point.Writing results…Writing results…Running OpenCL program: %1Running OpenCL program: %1Error running OpenCL program: %1 - %2Error running OpenCL program: %1 - %2Error loading OpenCL program sourcesError loading OpenCL program sourcesError %1 initializing OpenCL device: %2Error %1 initializing OpenCL device: %2No OpenCL 1.x device could be found.No OpenCL 1.x device could be found.No OpenCL 1.x platform found.No OpenCL 1.x platform found.Error setting default platform.Error setting default platform.Active OpenCL device: %1Active OpenCL device: %1Error %1 searching for OpenCL device: %2Error %1 searching for OpenCL device: %2Could not load OpenCL program from path %1.Could not load OpenCL program from path %1.Build logs not available!Build logs not available!Error building OpenCL program: %1Error building OpenCL program: %1Error %1 building OpenCL program in %2Error %1 building OpenCL program in %2Error loading OpenCL program source from pathError loading OpenCL program source from pathOpenCL has been disabled, you can re-enable it in the options dialog.OpenCL has been disabled, you can re-enable it in the options dialog.Interpolate point on lineInterpolate point on linelinestring,reference,referencing,distance,interpolatelinestring,reference,referencing,distance,interpolateInterpolated pointsInterpolated pointsThis algorithm creates a point geometry interpolated at a set distance along line or curve geometries.
Z and M values are linearly interpolated from existing values.
If a multipart geometry is encountered, only the first part is considered when interpolating the point.
If the specified distance is greater than the curve's length, the resultant feature will have a null geometry.This algorithm creates a point geometry interpolated at a set distance along line or curve geometries.
Z and M values are linearly interpolated from existing values.
If a multipart geometry is encountered, only the first part is considered when interpolating the point.
If the specified distance is greater than the curve's length, the resultant feature will have a null geometry.Interpolates a point along lines at a set distance.Interpolates a point along lines at a set distance.Line substringLine substringlinestring,curve,split,shorten,shrink,portion,part,reference,referencing,distance,interpolatelinestring,curve,split,shorten,shrink,portion,part,reference,referencing,distance,interpolateSubstringSubstringThis algorithm returns the portion of a line (or curve) which falls between the specified start and end distances (measured from the beginning of the line).
Z and M values are linearly interpolated from existing values.
If a multipart geometry is encountered, only the first part is considered when calculating the substring.This algorithm returns the portion of a line (or curve) which falls between the specified start and end distances (measured from the beginning of the line).
Z and M values are linearly interpolated from existing values.
If a multipart geometry is encountered, only the first part is considered when calculating the substring.Returns the substring of lines which fall between start and end distances.Returns the substring of lines which fall between start and end distances.3D Map3D MapNo 3D maps definedNo 3D maps definedCan not open srs database (%1): %2Can not open srs database (%1): %2%1 [optional]%1 [optional]Categorize using expressionCategorize using expressionStyle database (leave blank to use saved symbols)Style database (leave blank to use saved symbols)Use case-sensitive match to symbol namesUse case-sensitive match to symbol namesIgnore non-alphanumeric characters while matchingIgnore non-alphanumeric characters while matchingCategorized layerCategorized layerNon-matching categoriesNon-matching categoriesNon-matching symbol namesNon-matching symbol namesCreate categorized renderer from stylesCreate categorized renderer from stylesfile,database,symbols,names,category,categoriesfile,database,symbols,names,category,categoriesCartographyCartographySets a vector layer's renderer to a categorized renderer using matching symbols from a style database. If no style file is specified, symbols from the user's current style library are used instead.
The specified expression (or field name) is used to create categories for the renderer. A category will be created for each unique value within the layer.
Each category is individually matched to the symbols which exist within the specified QGIS XML style database. Whenever a matching symbol name is found, the category's symbol will be set to this matched symbol.
The matching is case-insensitive by default, but can be made case-sensitive if required.
Optionally, non-alphanumeric characters in both the category value and symbol name can be ignored while performing the match. This allows for greater tolerance when matching categories to symbols.
If desired, tables can also be output containing lists of the categories which could not be matched to symbols, and symbols which were not matched to categories.Sets a vector layer's renderer to a categorized renderer using matching symbols from a style database. If no style file is specified, symbols from the user's current style library are used instead.
The specified expression (or field name) is used to create categories for the renderer. A category will be created for each unique value within the layer.
Each category is individually matched to the symbols which exist within the specified QGIS XML style database. Whenever a matching symbol name is found, the category's symbol will be set to this matched symbol.
The matching is case-insensitive by default, but can be made case-sensitive if required.
Optionally, non-alphanumeric characters in both the category value and symbol name can be ignored while performing the match. This allows for greater tolerance when matching categories to symbols.
If desired, tables can also be output containing lists of the categories which could not be matched to symbols, and symbols which were not matched to categories.Sets a vector layer's renderer to a categorized renderer using symbols from a style database.Sets a vector layer's renderer to a categorized renderer using symbols from a style database.An error occurred while reading style file: %1An error occurred while reading style file: %1Matched %1 categories to symbols from file.Matched %1 categories to symbols from file.No categories could be matched to symbols in file.No categories could be matched to symbols in file.
%1 categories could not be matched:
%1 categories could not be matched:
%1 symbols in style were not matched:
%1 symbols in style were not matched:No raster layer for entry %1No raster layer for entry %1Band number %1 is not valid for entry %2Band number %1 is not valid for entry %2Could not allocate required memory for %1Could not allocate required memory for %1Could not obtain driver for %1Could not obtain driver for %1Could not create output %1Could not create output %1Request started [url: %1]Request started [url: %1]Request failed [error: no reply - url: %1]Request failed [error: no reply - url: %1]Request failed [error: %1 - url: %2]Request failed [error: %1 - url: %2]Request error [status: %1 - reason phrase: %2] for %3Request error [status: %1 - reason phrase: %2] for %3Request finished [url: %1]Request finished [url: %1]Error %1Error %1QTermWidgetColor Scheme ErrorColor Scheme ErrorCannot load color scheme: %1Cannot load color scheme: %1QgisAppMultiple Instances of QgisAppMultiple Instances of QgisAppChecking databaseChecking databaseReading settingsReading settingsSetting up the GUISetting up the GUIMap canvas. This is where raster and vector layers are displayed when added to the mapMap canvas. This is where raster and vector layers are displayed when added to the mapCtrl+5Ctrl+5Show Undo/Redo PanelShow Undo/Redo PanelCtrl+4Ctrl+4Show Advanced Digitizing PanelShow Advanced Digitizing PanelCtrl+6Ctrl+6Show Statistics PanelShow Statistics PanelCtrl+7Ctrl+7Show Bookmarks PanelShow Bookmarks PanelCtrl+3Ctrl+3Show Style PanelShow Style PanelSnapping and Digitizing OptionsSnapping and Digitizing OptionsProject Snapping SettingsProject Snapping SettingsChecking provider pluginsChecking provider pluginsStarting PythonStarting PythonRestoring loaded pluginsRestoring loaded pluginsInitializing file filtersInitializing file filtersRestoring window stateRestoring window statePopulate saved stylesPopulate saved stylesQGIS Ready!QGIS Ready!Zoom in to canvasZoom in to canvasZoom in to canvas (secondary)Zoom in to canvas (secondary)Zoom out of canvasZoom out of canvasZoom in (secondary)Zoom in (secondary)Shift+F6Shift+F6Open Attribute Table (Selected Features)Open Attribute Table (Selected Features)Ctrl+F6Ctrl+F6Open Attribute Table (Visible Features)Open Attribute Table (Visible Features)Loading layersLoading layersMinimizeMinimizeCtrl+MMinimize WindowCtrl+MMinimizes the active window to the dockMinimizes the active window to the dockZoomZoomToggles between a predefined size and the window size set by the userToggles between a predefined size and the window size set by the userBring All to FrontBring All to FrontBring forward all open windowsBring forward all open windowsCurrent EditsCurrent EditsErrorErrorFailed to open Python console:Failed to open Python console:Multiple instances of QGIS application object detected.
Please contact the developers.
Multiple instances of QGIS application object detected.
Please contact the developers.
Ctrl+2Ctrl+2Show Browser PanelShow Browser PanelCtrl+0Ctrl+0Show GPS Information PanelShow GPS Information PanelQGIS - %1 ('%2')QGIS - %1 ('%2')PanelsPanelsToolbarsToolbarsWindowWindow&Database&Database&Web&WebRenderRenderWhen checked, the map layers are rendered in response to map navigation commands and other events. When not checked, no rendering is done. This allows you to add a large number of layers and symbolize them before rendering.When checked, the map layers are rendered in response to map navigation commands and other events. When not checked, no rendering is done. This allows you to add a large number of layers and symbolize them before rendering.Toggle map renderingToggle map renderingCRS status - Click to open coordinate reference system dialogCRS status - Click to open coordinate reference system dialogReadyReadyMap overview canvas. This canvas can be used to display a locator map that shows the current extent of the map canvas. The current extent is shown as a red rectangle. Any layer on the map can be added to the overview canvas.Map overview canvas. This canvas can be used to display a locator map that shows the current extent of the map canvas. The current extent is shown as a red rectangle. Any layer on the map can be added to the overview canvas.Map layer list that displays all layers in drawing order.Map layer list that displays all layers in drawing order.Private qgis.dbPrivate qgis.dbQGISQGISLayer StylingLayer StylingCtrl++Ctrl++Ctrl+=Ctrl+=Ctrl+-Ctrl+-Ctrl+Alt+=Ctrl+Alt+=&User Profiles&User Profiles ° °This icon shows whether on the fly coordinate reference system transformation is enabled or not. Click the icon to bring up the project properties dialog to alter this behavior.This icon shows whether on the fly coordinate reference system transformation is enabled or not. Click the icon to bring up the project properties dialog to alter this behavior.Ctrl+KCtrl+KTrigger LocatorTrigger LocatorTransforms are not installed: %1 Transforms are not installed: %1 Missing datum transformsMissing datum transformsOverviewOverviewMap legend that displays all the layers currently on the map canvas. Click on the checkbox to turn a layer on or off. Double-click on a layer in the legend to customize its appearance and set other properties.Map legend that displays all the layers currently on the map canvas. Click on the checkbox to turn a layer on or off. Double-click on a layer in the legend to customize its appearance and set other properties.LayersLayersManage Map ThemesManage Map ThemesLayer OrderLayer OrderCtrl+9Ctrl+9Show Layer Order PanelShow Layer Order Panel< Blank >< Blank >http://qgis.org/en/site/about/sponsorship.htmlhttp://qgis.org/en/site/about/sponsorship.htmlQGIS versionQGIS versionQGIS code revisionQGIS code revisionCompiled against QtCompiled against QtRunning against QtRunning against QtCompiled against GDAL/OGRCompiled against GDAL/OGRRunning against GDAL/OGRRunning against GDAL/OGRPostgreSQL Client VersionPostgreSQL Client VersionSpatiaLite VersionSpatiaLite VersionQWT VersionQWT VersionPROJ.4 VersionPROJ.4 VersionQScintilla2 VersionQScintilla2 VersionThis copy of QGIS writes debugging output.This copy of QGIS writes debugging output.Invalid Data SourceInvalid Data Source%1 is not a valid or recognized data source%1 is not a valid or recognized data sourceVectorVector%1 is an invalid layer - not loaded%1 is an invalid layer - not loaded%1 is an invalid layer and cannot be loaded. Please check the <a href="#messageLog">message log</a> for further info.%1 is an invalid layer and cannot be loaded. Please check the <a href="#messageLog">message log</a> for further info.QGIS filesQGIS filesDiagram PropertiesDiagram PropertiesNew temporary scratch layer nameNew temporary scratch layer nameCannot create new layer.Cannot create new layer.Cannot copy styleCannot copy styleCannot parse styleCannot parse styleCannot paste styleCannot paste styleNo legend entries selectedNo legend entries selectedSelect the layers and groups you want to remove in the legend.Select the layers and groups you want to remove in the legend.Remove layers and groupsRemove layers and groupsRemove %n legend entries?number of legend items to removeRemove %n legend entries?Remove %n legend entries?%n legend entries removed.number of removed legend entries%n legend entries removed.%n legend entries removed.%1 (%2 type unsupported)%1 (%2 type unsupported)Cannot copy style to duplicated layer.Cannot copy style to duplicated layer.https://qgis.org/en/site/getinvolved/development/bugreporting.htmlhttps://qgis.org/en/site/getinvolved/development/bugreporting.htmlThe layer %1 is not a valid layer and can not be added to the map. Reason: %2The layer %1 is not a valid layer and can not be added to the map. Reason: %2Map %1Map %1Project extent is not valid.Project extent is not valid.3D view currently does not support unprojected coordinate reference systems (CRS).
Please switch project's CRS to a projected CRS.3D view currently does not support unprojected coordinate reference systems (CRS).
Please switch project's CRS to a projected CRS.3D Map %13D Map %1Do you want to save the current project? %1Do you want to save the current project? %1Active TasksActive TasksUntitled ProjectUntitled ProjectUndo/RedoUndo/RedoAdvanced DigitizingAdvanced DigitizingBrowserBrowserBrowser (2)Browser (2)GPS InformationGPS InformationLog MessagesLog MessagesQGIS starting…QGIS starting…Preferences…Preferences…Open Active Profile FolderOpen Active Profile FolderNew Profile…New Profile…Filter Legend by Map ContentFilter Legend by Map ContentOpen the Layer Styling panelOpen the Layer Styling panelCompiled against PROJCompiled against PROJRunning against PROJRunning against PROJAdd Virtual LayerAdd Virtual LayerRevert ProjectRevert ProjectAre you sure you want to discard all unsaved changes the current project?Are you sure you want to discard all unsaved changes the current project?Save Project AsSave Project AsLayer ExportedLayer ExportedSave RasterSave RasterCannot write raster. Error code: %1Cannot write raster. Error code: %1Merging features…Merging features…Create %1 TitleCreate %1 TitleNo features could be successfully pasted.No features could be successfully pasted.Error copying layerError copying layerError pasting layerError pasting layerStop EditingStop EditingThe following tasks are currently running which depend on layers in this project:
%1
Please cancel these tasks and retry.The following tasks are currently running which depend on layers in this project:
%1
Please cancel these tasks and retry.Current CRS: %1Current CRS: %1No projectionNo projectionAdd Point FeatureAdd Point FeatureAdd Line FeatureAdd Line FeatureAdd Polygon FeatureAdd Polygon FeatureAdd RecordAdd RecordMap ViewsMap ViewsA view with this name already existsA view with this name already existsInvalid LayerInvalid LayerDefault failed to open: %1Default failed to open: %1Default not found: %1Default not found: %1Open Template ProjectOpen Template ProjectAuto-open ProjectAuto-open ProjectFailed to open: %1Failed to open: %1Not valid project file: %1Not valid project file: %1Project failed to open: %1Project failed to open: %1Default template has been reopened: %1Default template has been reopened: %1File not found: %1File not found: %1Loading project: %1Loading project: %1Unable to open projectUnable to open projectSecurity warningSecurity warningproject macros have been disabled.project macros have been disabled.Enable macrosEnable macrosCtrl+8Ctrl+8Show Overview PanelShow Overview PanelCtrl+1Ctrl+1Show Layers PanelShow Layers PanelProject loadedProject loadedChoose a QGIS project fileChoose a QGIS project fileSaved project to: %1Saved project to: %1Unable to save project %1Unable to save project %1Unable to load %1Unable to load %1Default system font substituted.Default system font substituted.LabelingLabelingFont for layer <b><u>%1</u></b> was not found (<i>%2</i>). %3Font for layer <b><u>%1</u></b> was not found (<i>%2</i>). %3Open labeling dialogOpen labeling dialogCRS was undefinedCRS was undefineddefaulting to project CRS %1 - %2defaulting to project CRS %1 - %2defaulting to CRS %1 - %2defaulting to CRS %1 - %2RotationRotationAdd GroupAdd GroupFilter legend by expressionFilter legend by expressionExpand AllExpand AllCollapse AllCollapse AllQGIS code branchQGIS code branchCompiled against GEOSCompiled against GEOSRunning against GEOSRunning against GEOSNo supportNo support%1 doesn't have any layers.%1 doesn't have any layers.%1 is not a valid or recognized data source.%1 is not a valid or recognized data source.RasterRasterCannot get virtual layer select dialog from provider.Cannot get virtual layer select dialog from provider.Layer creation failed. Please check the <a href="#messageLog">message log</a> for further information.Layer creation failed. Please check the <a href="#messageLog">message log</a> for further information.Calculating…Calculating…Raster calculatorRaster calculatorCalculation complete.Calculation complete.Could not create destination file.Could not create destination file.Could not read input layer.Could not read input layer.Could not parse raster formula.Could not parse raster formula.Insufficient memory available for operation.Insufficient memory available for operation.Invalid band number for input layer.Invalid band number for input layer.Choose a QGIS Project File to OpenChoose a QGIS Project File to OpenDo you want to open the backup file
%1
instead?Do you want to open the backup file
%1
instead?QGZ filesQGZ filesOpen a ProjectOpen a ProjectThe loaded project file on disk was meanwhile changed. Do you want to overwrite the changes?
Last modification date on load was: %1
Current last modification date is: %2The loaded project file on disk was meanwhile changed. Do you want to overwrite the changes?
Last modification date on load was: %1
Current last modification date is: %2Insufficient permissionsInsufficient permissionsThe project file is not writable.The project file is not writable.DXF export completedDXF export completedDXF export failedDXF export failedLoad templateLoad templateCould not read template fileCould not read template fileCould not load template fileCould not load template fileNo action selectedNo action selectedRun feature action<br><b>%1</b>Run feature action<br><b>%1</b>Commit ErrorsCommit ErrorsCommit errorsCommit errorsCould not commit changes to layer %1Could not commit changes to layer %1Errors: %1
Errors: %1
Show moreShow morePlease select a vector layer firstPlease select a vector layer firstExport to vector file failed.
Error: %1Export to vector file failed.
Error: %1No Layer SelectedNo Layer SelectedTo delete features, you must select a vector layer in the legendTo delete features, you must select a vector layer in the legendNo Vector Layer SelectedNo Vector Layer SelectedDeleting features only works on vector layersDeleting features only works on vector layersProvider does not support deletionProvider does not support deletionData provider does not support deleting featuresData provider does not support deleting featuresLayer not editableLayer not editableThe current layer is not editable. Choose 'Start editing' in the digitizing toolbar.The current layer is not editable. Choose 'Start editing' in the digitizing toolbar.No Features SelectedNo Features SelectedFeatures deletedFeatures deletedProblem deleting featuresProblem deleting features%n feature(s) deleted.number of features deleted%n feature(s) deleted.%n feature(s) deleted.AbortAbortTitle can not be empty!Title can not be empty!Title already exists!Title already exists!No active layerNo active layerNo active layer found. Please select a layer in the layer listNo active layer found. Please select a layer in the layer listNot enough features selectedNot enough features selectedThe merge tool requires at least two selected featuresThe merge tool requires at least two selected featuresMerged feature attributesMerged feature attributes • %1 • %1The following tasks are currently running in the background:
%1
Do you want to try canceling these active tasks?The following tasks are currently running in the background:
%1
Do you want to try canceling these active tasks?Layer Diagram PropertiesLayer Diagram PropertiesSuccessfully saved raster layer to <a href="%1">%2</a>Successfully saved raster layer to <a href="%1">%2</a>Error saving layer definition fileError saving layer definition fileSave as QGIS Layer Style FileSave as QGIS Layer Style FileQGIS Layer Style FileQGIS Layer Style FileSuccessfully saved vector layer to <a href="%1">%2</a>Successfully saved vector layer to <a href="%1">%2</a>Save ErrorSave ErrorLoading “%1”Loading “%1”Security warning: executing a script from an untrusted source can lead to data loss and/or leak. Continue?Security warning: executing a script from an untrusted source can lead to data loss and/or leak. Continue?Don't show this again.Don't show this again.Layer SavedLayer SavedSuccessfully saved scratch layer to <a href="%1">%2</a>Successfully saved scratch layer to <a href="%1">%2</a>Could not make temporary scratch layer permanent.
Error: %1Could not make temporary scratch layer permanent.
Error: %1Save Scratch LayerSave Scratch LayerDelete %n feature(s) from layer "%1"Delete %n feature(s) from layer "%1"Delete %n feature(s) from layer "%1"Some of the selected features are outside of the current map view. Would you still like to continue?Some of the selected features are outside of the current map view. Would you still like to continue?A problem occurred during deletion from layer "%1". %n feature(s) not deleted.A problem occurred during deletion from layer "%1". %n feature(s) not deleted.A problem occurred during deletion from layer "%1". %n feature(s) not deleted.print layoutprint layoutreportreportEnter a unique %1 titleEnter a unique %1 title(a title will be automatically generated if left empty)(a title will be automatically generated if left empty)%1 copy%1 copySet as atlas feature for %1Set as atlas feature for %1Duplicate featureDuplicate featureDuplicate feature and digitizeDuplicate feature and digitizeThe merge tool requires at least two selected features.The merge tool requires at least two selected features.Invalid resultInvalid resultCould not store value '%1' in field of type %2Could not store value '%1' in field of type %2Modifying features can only be done for layers in editing mode.Modifying features can only be done for layers in editing mode.Merge failedMerge failedAn error occurred during the merge operation.An error occurred during the merge operation.Merged featuresMerged featuresCould not store value '%1' in field of type %2.Could not store value '%1' in field of type %2. {1'?}No active vector layerNo active vector layerTo invert selection, choose a vector layer in the legendTo invert selection, choose a vector layer in the legendFeatures cutFeatures cutFeatures pastedFeatures pastedPaste featuresPaste features%1 features were successfully pasted.%1 features were successfully pasted.Geometry ValidationGeometry ValidationCould not save changes. Geometry validation failed.Could not save changes. Geometry validation failed.%1 of %2 features could be successfully pasted.%1 of %2 features could be successfully pasted. Geometry collapsed due to intersection avoidance. Geometry collapsed due to intersection avoidance.%1 geometries collapsed due to intersection avoidance.%1 geometries collapsed due to intersection avoidance.PastedPastedLayer nameLayer nameNo features in clipboard.No features in clipboard.Multiple geometry types found, features with geometry different from %1 will be created without geometry.Multiple geometry types found, features with geometry different from %1 will be created without geometry.Cannot create field %1 (%2,%3)Cannot create field %1 (%2,%3)Start editing failedStart editing failedProvider cannot be opened for editingProvider cannot be opened for editingDo you want to save the changes to layer %1?Do you want to save the changes to layer %1?Problems during roll backProblems during roll backCould not %1 changes to layer %2
Errors: %3
Could not %1 changes to layer %2
Errors: %3
rollbackrollbackcancelcancelSaveSaveallallRollbackRollbackCancelCancelCurrent editsCurrent edits%1 current changes for %2 layer(s)?%1 current changes for %2 layer(s)?Filter on Joined FieldsFilter on Joined FieldsYou are about to set a subset filter on a layer that has joined fields. Joined fields cannot be filtered, unless you convert the layer to a virtual layer first. Would you like to create a virtual layer out of this layer first?You are about to set a subset filter on a layer that has joined fields. Joined fields cannot be filtered, unless you convert the layer to a virtual layer first. Would you like to create a virtual layer out of this layer first?Datum transformsDatum transformsProject CRS changed and datum transforms might need to be adapted.Project CRS changed and datum transforms might need to be adapted.Required LayersRequired LayersThe following layers are marked as required by the project:
%1
Please deselect them (or unmark as required) and retry.The following layers are marked as required by the project:
%1
Please deselect them (or unmark as required) and retry.The following tasks are currently running which depend on this layer:
%1
Please cancel these tasks and retry.The following tasks are currently running which depend on this layer:
%1
Please cancel these tasks and retry.copycopyPlugin layerPlugin layerMemory layerMemory layerDuplicate layer: Duplicate layer: %1 (duplication resulted in invalid layer)%1 (duplication resulted in invalid layer)Layer duplication completeLayer duplication completeNote that it's using the same data source.Note that it's using the same data source.Set scale visibility for selected layersSet scale visibility for selected layersCouldn't load Python support library: %1Couldn't load Python support library: %1Couldn't resolve python support library's instance() symbol.Couldn't resolve python support library's instance() symbol.Python support ENABLED :-) Python support ENABLED :-) There is a new version of QGIS availableThere is a new version of QGIS availableYou are running a development version of QGISYou are running a development version of QGISYou are running the current version of QGISYou are running the current version of QGISQGIS Version InformationQGIS Version InformationUnable to get current version information from serverUnable to get current version information from serverStyle ManagerStyle ManagerKeyboard ShortcutsKeyboard ShortcutsCustom ProjectionsCustom ProjectionsInterface CustomizationInterface CustomizationTo perform a full histogram stretch, you need to have a raster layer selected.To perform a full histogram stretch, you need to have a raster layer selected.To change brightness or contrast, you need to have a raster layer selected.To change brightness or contrast, you need to have a raster layer selected.Save ProjectSave ProjectClose ProjectClose ProjectThis project includes one or more temporary scratch layers. These layers are not saved to disk and their contents will be permanently lost. Are you sure you want to proceed?This project includes one or more temporary scratch layers. These layers are not saved to disk and their contents will be permanently lost. Are you sure you want to proceed?Task failedTask failedQGIS AuthenticationQGIS Authentication%1 Panel%1 PanelTransactionTransactionCannot duplicate feature in not editable mode on layer %1Cannot duplicate feature in not editable mode on layer %1%1 children on layer %2 duplicated%1 children on layer %2 duplicated%1 features on layer %2 duplicated
%3%1 features on layer %2 duplicated
%3Digitize the duplicate on layer %1Digitize the duplicate on layer %1Duplicate digitizedDuplicate digitizedFeature on layer %2 duplicated
%3Feature on layer %2 duplicated
%3Save as Local FileSave as Local Filehttps://qgis.org/en/site/forusers/commercial_support.htmlhttps://qgis.org/en/site/forusers/commercial_support.htmlLayer is not validLayer is not validLayer %1Layer %1The merge features tool only works on vector layers.The merge features tool only works on vector layers.Merging features can only be done for layers in editing mode.Merging features can only be done for layers in editing mode.Please select a layer in the layer listPlease select a layer in the layer listInvalid layerInvalid layerTo select all, choose a vector layer in the legend.To select all, choose a vector layer in the legend.To select features, choose a vector layer in the legend.To select features, choose a vector layer in the legend.The layer is not a valid layer and can not be added to the mapThe layer is not a valid layer and can not be added to the mapProject has layer(s) in edit mode with unsaved edits, which will NOT be saved!Project has layer(s) in edit mode with unsaved edits, which will NOT be saved!%n feature(s) selected on layer %1.number of selected features%n feature(s) selected on layer %1.%n feature(s) selected on layer %1.Open a GDAL Supported Raster Data SourceOpen a GDAL Supported Raster Data SourceError adding valid layer to map canvasError adding valid layer to map canvasRaster layerRaster layer%1 is not a supported raster data source%1 is not a supported raster data sourceUnsupported Data SourceUnsupported Data SourceExit QGISExit QGISDo you really want to quit QGIS?Do you really want to quit QGIS?New profile nameNew profile nameTask completeTask completeThis project file was saved by an older version of QGIS. When saving this project file, QGIS will update it to the latest version, possibly rendering it useless for older versions of QGIS.This project file was saved by an older version of QGIS. When saving this project file, QGIS will update it to the latest version, possibly rendering it useless for older versions of QGIS.Project file is olderProject file is older Please check the <a href="#messageLog">message log</a> for further info. Please check the <a href="#messageLog">message log</a> for further info.A network request timed out, any data received is likely incomplete.A network request timed out, any data received is likely incomplete.WarningWarningThis layer doesn't have a properties dialog.This layer doesn't have a properties dialog.Authentication requiredAuthentication requiredProxy authentication requiredProxy authentication requiredFailed to run Python script:Failed to run Python script:The current layer has no selected featuresThe current layer has no selected featuresCurrent clockwise map rotation in degreesCurrent clockwise map rotation in degreesShows the current map clockwise rotation in degrees. It also allows editing to set the rotationShows the current map clockwise rotation in degrees. It also allows editing to set the rotationMessagesMessagesError loading layer definitionError loading layer definitionQgisAppInterfaceAttributes changedAttributes changedQgisCustomWidgetsQGIS custom widgetsQGIS custom widgetsQgs25DRendererWidgetThe 2.5D renderer only can be used with polygon layers.
'%1' is not a polygon layer and cannot be rendered in 2.5D.The 2.5D renderer only can be used with polygon layers.
'%1' is not a polygon layer and cannot be rendered in 2.5D.Select Wall ColorSelect Wall ColorSelect Roof ColorSelect Roof ColorSelect Shadow ColorSelect Shadow ColorQgs25DRendererWidgetBaseFormFormHeightHeightAngleAngleAdvanced ConfigurationAdvanced Configuration……Roof colorRoof colorWall colorWall color<html><head/><body><p>Walls will have a different color based on their aspect to make them appear to differently reflect the solar radiation.</p><p><br/></p><p>If this option is enabled, make sure that <span style=" font-style:italic;">simplification </span>is disabled on the rendering tab or some colors may be wrong at small scales.</p></body></html><html><head/><body><p>Walls will have a different color based on their aspect to make them appear to differently reflect the solar radiation.</p><p><br/></p><p>If this option is enabled, make sure that <span style=" font-style:italic;">simplification </span>is disabled on the rendering tab or some colors may be wrong at small scales.</p></body></html>Shade walls based on aspectShade walls based on aspectShadowShadowColorColorSizeSize°°<html><head/><body><p><span style=" font-weight:600;">Advanced Styling</span><br/>This page helps to configure the 2.5D effect as easily as possible with some basic parameters.</p><p>Once you have finished the basic styling, you can convert this to another renderer (single, categorized, graduated) and fine-tune the appearance to your liking.</p><p><span style=" font-weight:600;">Overlay problems</span></p><p>Features are rendered based on their distance to the camera. It is sometimes possible that parts of a feature are in front of another feature by mistake. This happens if any part of the overlapped feature is closer to the camera than the overlapping feature.</p><p>In such cases you can avoid rendering problems by cutting the feature in front into smaller pieces.</p></body></html><html><head/><body><p><span style=" font-weight:600;">Advanced Styling</span><br/>This page helps to configure the 2.5D effect as easily as possible with some basic parameters.</p><p>Once you have finished the basic styling, you can convert this to another renderer (single, categorized, graduated) and fine-tune the appearance to your liking.</p><p><span style=" font-weight:600;">Overlay problems</span></p><p>Features are rendered based on their distance to the camera. It is sometimes possible that parts of a feature are in front of another feature by mistake. This happens if any part of the overlapped feature is closer to the camera than the overlapping feature.</p><p>In such cases you can avoid rendering problems by cutting the feature in front into smaller pieces.</p></body></html>Qgs3DAlgorithmsQGIS (3D)QGIS (3D)Qgs3DAnimationWidget<none><none>Keyframe timeKeyframe timeKeyframe time [seconds]:Keyframe time [seconds]:There is already a keyframe at the given timeThere is already a keyframe at the given timeQgs3DMapCanvasDockWidgetZoom FullZoom FullSave as Image…Save as Image…Configure…Configure…AnimationsAnimationsIdentifyIdentifySave as ImageSave as ImageSuccessfully saved the 3D map to <a href="%1">%2</a>Successfully saved the 3D map to <a href="%1">%2</a>Choose a file name to save the 3D map canvas to an imageChoose a file name to save the 3D map canvas to an image3D Configuration3D ConfigurationLoading %1 tilesLoading %1 tilesQgsAboutAboutAboutAbout QGISAbout QGISLicenseLicense<html><head><meta name="qrichtext" content="1" /><style type="text/css">
p, li { white-space: pre-wrap; }
</style></head><body style=" font-family:'Lucida Grande'; font-size:13pt; font-weight:400; font-style:normal;">
<p style=" margin-top:16px; margin-bottom:12px; margin-left:0px; margin-right:0px; -qt-block-indent:0; text-indent:0px; font-size:x-large; font-weight:600;"><span style=" font-size:x-large;">QGIS</span></p></body></html><html><head><meta name="qrichtext" content="1" /><style type="text/css">
p, li { white-space: pre-wrap; }
</style></head><body style=" font-family:'Lucida Grande'; font-size:13pt; font-weight:400; font-style:normal;">
<p style=" margin-top:16px; margin-bottom:12px; margin-left:0px; margin-right:0px; -qt-block-indent:0; text-indent:0px; font-size:x-large; font-weight:600;"><span style=" font-size:x-large;">QGIS</span></p></body></html>QGIS is licensed under the GNU General Public LicenseQGIS is licensed under the GNU General Public Licensehttp://www.gnu.org/licenseshttp://www.gnu.org/licensesQGIS Home PageQGIS Home PageJoin our user mailing listJoin our user mailing listabout:blankabout:blankWhat's NewWhat's NewProvidersProvidersDevelopersDevelopersContributorsContributorsTranslatorsTranslatorsDonorsDonors<p>For a list of individuals and institutions who have contributed money to fund QGIS development and other project costs see <a href="http://qgis.org/en/site/about/sponsorship.html#list-of-donors">http://qgis.org/en/site/about/sponsorship.html#list-of-donors</a></p><p>For a list of individuals and institutions who have contributed money to fund QGIS development and other project costs see <a href="http://qgis.org/en/site/about/sponsorship.html#list-of-donors">http://qgis.org/en/site/about/sponsorship.html#list-of-donors</a></p>Available QGIS Data Provider PluginsAvailable QGIS Data Provider PluginsAvailable QGIS Authentication Method PluginsAvailable QGIS Authentication Method PluginsAvailable Qt Database PluginsAvailable Qt Database PluginsAvailable Qt Image PluginsAvailable Qt Image PluginsQt Image Plugin Search Paths <br>Qt Image Plugin Search Paths <br>Developers MapDevelopers MapQgsAbstractDataSourceWidget&Add&AddAdd selected layers to mapAdd selected layers to mapClose this dialog without adding any layerClose this dialog without adding any layerQgsActionLocatorFilterActionsActionsQgsActionMenu&Actions&ActionsNot supported on your platformNot supported on your platformQgsActionScopeRegistryCanvasCanvasAvailable for the action map tool on the canvas.Available for the action map tool on the canvas.Field ScopeField ScopeAvailable for individual fields. For example in the attribute table.Available for individual fields. For example in the attribute table.Feature ScopeFeature ScopeAvailable for individual features. For example on feature forms or per row in the attribute table.Available for individual features. For example on feature forms or per row in the attribute table.Layer ScopeLayer ScopeAvailable as layer global action. For example on top of the attribute table.Available as layer global action. For example on top of the attribute table.QgsActiveLayerFeaturesLocatorFilterActive Layer FeaturesActive Layer FeaturesQgsAddAttrDialogAdd FieldAdd FieldInvalid field name. This field name is reserved and cannot be used.Invalid field name. This field name is reserved and cannot be used.No name specified. Please specify a name to create a new field.No name specified. Please specify a name to create a new field.QgsAddAttrDialogBaseN&ameN&ameCommentCommentTypeTypeAdd FieldAdd FieldPrecisionPrecisionLengthLengthProvider typeProvider typeQgsAddTabOrGroupAdd Tab or Group for %1Add Tab or Group for %1QgsAddTabOrGroupBaseDialogDialogCreate categoryCreate categoryasasa taba taba group in containera group in containerNumber of columnsNumber of columnsQgsAdvancedDigitizingDockWidgetSome constraints are incompatible. Resulting point might be incorrect.Some constraints are incompatible. Resulting point might be incorrect.Do Not Snap to Common AnglesDo Not Snap to Common Angles%1, %2, %3, %4°…%1, %2, %3, %4°…Construction modeConstruction modepress c to toggle on/offpress c to toggle on/offDistanceDistancepress d for quick accesspress d for quick accessLock distanceLock distancepress Ctrl + d for quick accesspress Ctrl + d for quick accessContinuously lock distanceContinuously lock distanceToggles relative angle to previous segmentToggles relative angle to previous segmentpress Shift + a for quick accesspress Shift + a for quick accessAngleAnglepress a for quick accesspress a for quick accessLock angleLock anglepress Ctrl + a for quick accesspress Ctrl + a for quick accessContinuously lock angleContinuously lock angleToggles relative x to previous nodeToggles relative x to previous nodepress Shift + x for quick accesspress Shift + x for quick accessX coordinateX coordinatepress x for quick accesspress x for quick accessLock x coordinateLock x coordinatepress Ctrl + x for quick accesspress Ctrl + x for quick accessContinuously lock x coordinateContinuously lock x coordinateToggles relative y to previous nodeToggles relative y to previous nodepress Shift + y for quick accesspress Shift + y for quick accessY coordinateY coordinatepress y for quick accesspress y for quick accessLock y coordinateLock y coordinatepress Ctrl + y for quick accesspress Ctrl + y for quick accessContinuously lock y coordinateContinuously lock y coordinateSnapping must be enabled to utilize perpendicular modeSnapping must be enabled to utilize perpendicular modeSnapping must be enabled to utilize parallel modeSnapping must be enabled to utilize parallel modePerpendicularPerpendicularpress p to switch between perpendicular, parallel and normal modepress p to switch between perpendicular, parallel and normal modeParallelParallelCAD tools are not enabled for the current map toolCAD tools are not enabled for the current map toolCAD tools can not be used on geographic coordinates. Change the coordinates system in the project properties.CAD tools can not be used on geographic coordinates. Change the coordinates system in the project properties.Enable advanced digitizing toolsEnable advanced digitizing toolsQgsAdvancedDigitizingDockWidgetBaseAdvanced DigitizingAdvanced DigitizingErrorError<html><head/><body><p><br/></p></body></html><html><head/><body><p><br/></p></body></html>……ddaaxxyyQgsAfsConnectionItemConnection failed: %1Connection failed: %1. {1?}RefreshRefreshEdit Connection…Edit Connection…Delete ConnectionDelete ConnectionModify ArcGIS Feature Server ConnectionModify ArcGIS Feature Server ConnectionQgsAfsProvidergetLayerInfo failedgetLayerInfo failedCould not retrieve layer extentCould not retrieve layer extentCould not parse spatial referenceCould not parse spatial referenceFailed to determine geometry typeFailed to determine geometry typegetObjectIds failed: %1 - %2getObjectIds failed: %1 - %2Failed to determine objectIdFieldName and/or objectIdsFailed to determine objectIdFieldName and/or objectIdsSourceSourceQgsAfsRootItemNew Connection…New Connection…Create a New ArcGIS Feature Server ConnectionCreate a New ArcGIS Feature Server ConnectionQgsAfsSourceSelectErrorErrorFailed to retrieve service capabilities:
%1: %2Failed to retrieve service capabilities:
%1: %2Layer %1: %2 - %3Layer %1: %2 - %3Failed to query some layers:
%1Failed to query some layers:
%1QgsAggregateToolButtonExcludeExcludeQgsAlignRasterDialogAlign RastersAlign RastersRaster layers to alignRaster layers to align++//--Output sizeOutput sizeReference layerReference layerCell sizeCell sizeGrid offsetGrid offsetAdd aligned rasters to map canvasAdd aligned rasters to map canvasCRSCRSClip to ExtentClip to Extent [best reference] [best reference]Failed to align rasters:Failed to align rasters:QgsAlignRasterLayerConfigDialogConfigure Layer ResamplingConfigure Layer ResamplingNearest neighbourNearest neighbourBilinear (2x2 kernel)Bilinear (2x2 kernel)Cubic (4x4 kernel)Cubic (4x4 kernel)Cubic B-Spline (4x4 kernel)Cubic B-Spline (4x4 kernel)Lanczos (6x6 kernel)Lanczos (6x6 kernel)AverageAverageModeModeMaximumMaximumMinimumMinimumMedianMedianFirst Quartile (Q1)First Quartile (Q1)Third Quartile (Q3)Third Quartile (Q3)Browse…Browse…Rescale values according to the cell sizeRescale values according to the cell sizeInput raster layer:Input raster layer:Output raster filename:Output raster filename:Resampling method:Resampling method:Select output fileSelect output fileGeoTIFFGeoTIFFQgsAllLayersFeaturesLocatorFilterFeatures In All LayersFeatures In All LayersQgsAmsConnectionItemEdit…Edit…DeleteDeleteModify ArcGIS Map Server ConnectionModify ArcGIS Map Server ConnectionQgsAmsProviderCould not parse spatial referenceCould not parse spatial referenceService InfoService InfoLayer InfoLayer InfoQgsAmsRootItemNew Connection…New Connection…Create a New ArcGIS Map Server ConnectionCreate a New ArcGIS Map Server ConnectionQgsAmsSourceSelectErrorErrorFailed to retrieve service capabilities:
%1: %2Failed to retrieve service capabilities:
%1: %2Layer %1: unable to parse spatial referenceLayer %1: unable to parse spatial referenceFailed to query some layers:
%1Failed to query some layers:
%1QgsAngleMagnetWidget°°Snap to Snap to No snappingNo snappingQgsAnnotationWidgetBaseFormFormFrame styleFrame styleFixed map positionFixed map positionContents MarginsContents MarginsTopTop mm mmBottomBottomLeftLeftRightRightAllows the annotation to be associated with a map layer. If set, the annotation will only be visible when the layer is visible.Allows the annotation to be associated with a map layer. If set, the annotation will only be visible when the layer is visible.Map markerMap markerLinked layerLinked layerQgsAppLayerTreeViewMenuProvider&Expand All&Expand All&Collapse All&Collapse All&Stretch Using Current Extent&Stretch Using Current ExtentZoom to &Visible ScaleZoom to &Visible ScaleSet &Project CRS from LayerSet &Project CRS from LayerMake Permanent…Make Permanent…Save Features As…Save Features As…Save Selected Features As…Save Selected Features As…Edit Symbol…Edit Symbol…&Open Attribute Table&Open Attribute TablePaste Layer/GroupPaste Layer/GroupCopy GroupCopy Group&Remove Group…&Remove Group…&Set Group CRS…&Set Group CRS…&Set Group WMS Data…&Set Group WMS Data…ExportExportCopy LayerCopy Layer&Duplicate Layer&Duplicate Layer&Remove Layer…&Remove Layer…&Set Layer Scale Visibility…&Set Layer Scale Visibility…Set CRSSet CRSSet Layer CRS…Set Layer CRS…Save as QGIS Layer Style File…Save as QGIS Layer Style File…&Properties…&Properties…Save as Layer Definition File…Save as Layer Definition File…&Filter…&Filter…Save As…Save As…Edit Virtual Layer…Edit Virtual Layer…&Show All Items&Show All Items&Hide All Items&Hide All ItemsSymbol SelectorSymbol Selector&Zoom to Native Resolution (100%)&Zoom to Native Resolution (100%)Copy StyleCopy StylePaste StylePaste StyleStylesStylesQgsApplicationExceptionExceptionunknown exceptionunknown exceptionApplication state:
QGIS_PREFIX_PATH env var: %1
Prefix: %2
Plugin Path: %3
Package Data Path: %4
Active Theme Name: %5
Active Theme Path: %6
Default Theme Path: %7
SVG Search Paths: %8
User DB Path: %9
Auth DB Path: %10
Application state:
QGIS_PREFIX_PATH env var: %1
Prefix: %2
Plugin Path: %3
Package Data Path: %4
Active Theme Name: %5
Active Theme Path: %6
Default Theme Path: %7
SVG Search Paths: %8
User DB Path: %9
Auth DB Path: %10
match indentation of application state[ERROR] Can not make qgis.db private copy[ERROR] Can not make qgis.db private copyCan not make '%1' user writableCan not make '%1' user writableCould not open qgis.dbCould not open qgis.dbMigration of private qgis.db failed.
%1Migration of private qgis.db failed.
%1Update of view in private qgis.db failed.
%1Update of view in private qgis.db failed.
%1QgsArcGisServiceSourceSelect&Build query&Build queryCreate a New %1 ConnectionCreate a New %1 ConnectionModify %1 ConnectionModify %1 ConnectionAre you sure you want to remove the %1 connection and all associated settings?Are you sure you want to remove the %1 connection and all associated settings?Confirm DeleteConfirm DeleteNo LayersNo LayersThe query returned no layers.The query returned no layers.QgsArcGisServiceSourceSelectBaseServer ConnectionsServer ConnectionsConnect to selected databaseConnect to selected databaseC&onnectC&onnectCreate a new database connectionCreate a new database connection&New&NewEdit selected database connectionEdit selected database connectionEditEditRemove connection to selected databaseRemove connection to selected databaseRemoveRemoveLoad connections from fileLoad connections from fileLoadLoadSave connections to fileSave connections to fileSaveSaveFi<erFi<erDisplay WFS FeatureTypes containing this word in the title, name or abstractDisplay WFS FeatureTypes containing this word in the title, name or abstractUse title for layer nameUse title for layer nameOnly request features overlapping the current view extentOnly request features overlapping the current view extentImage EncodingImage EncodingCoordinate Reference SystemCoordinate Reference SystemChange...Change...QgsArrowSymbolLayerWidgetBaseFormFormCurved arrowsCurved arrowsSingleSingle……Single, reversedSingle, reversedDoubleDoubleOffsetOffsetArrow typeArrow typeHead thicknessHead thicknessHead lengthHead length<html><head/><body><p>Plain: the arrow will be displayed entirely</p><p>Left/Exterior half: only the half of the head that is on the left of the arrow for straight arrows, or the one toward the exterior for curved arrows will be displayed</p><p>Right/Interior half: only the half of the head that is on the right of the arrow for straight arrows, or the one toward the interior for curved arrows will be displayed</p></body></html><html><head/><body><p>Plain: the arrow will be displayed entirely</p><p>Left/Exterior half: only the half of the head that is on the left of the arrow for straight arrows, or the one toward the exterior for curved arrows will be displayed</p><p>Right/Interior half: only the half of the head that is on the right of the arrow for straight arrows, or the one toward the interior for curved arrows will be displayed</p></body></html>PlainPlainLeft/Exterior halfLeft/Exterior halfRight/Interior halfRight/Interior halfArrow width at startArrow width at start<html><head/><body><p>If checked, one arrow will be rendered for each consecutive points (each 2 points for a straight arrow or 3 points for a curved arrow).</p><p>If unchecked, the arrow will be defined by extermum points of the line (the middle point will be used as a control point for a curved arrow)</p></body></html><html><head/><body><p>If checked, one arrow will be rendered for each consecutive points (each 2 points for a straight arrow or 3 points for a curved arrow).</p><p>If unchecked, the arrow will be defined by extermum points of the line (the middle point will be used as a control point for a curved arrow)</p></body></html>Repeat arrow on each segmentRepeat arrow on each segmentHead typeHead typeArrow widthArrow widthQgsAttributeActionDialogGenericGenericPythonPythonMacMacWindowsWindowsUnixUnixOpen URLOpen URLAdd New ActionAdd New ActionEcho attribute's valueEcho attribute's valueAttribute ValueAttribute ValueRun an applicationRun an applicationRun applicationRun applicationGet feature idGet feature idFeature IDFeature IDSelected field's value (Identify features tool)Selected field's value (Identify features tool)Field ValueField ValueClicked coordinates (Run feature actions tool)Clicked coordinates (Run feature actions tool)Clicked CoordinateClicked CoordinateOpen fileOpen fileSearch on web based on attribute's valueSearch on web based on attribute's valueSearch WebSearch WebList feature idsList feature idsDuplicate selected featuresDuplicate selected featuresDuplicate selectedDuplicate selectedEdit ActionEdit ActionQgsAttributeActionDialogBaseAttribute ActionsAttribute ActionsThis list contains all actions that have been defined for the current layer. Add actions by entering the details in the controls below and then pressing the Add to action list button. Actions can be edited here by double clicking on the item.This list contains all actions that have been defined for the current layer. Add actions by entering the details in the controls below and then pressing the Add to action list button. Actions can be edited here by double clicking on the item.TypeTypeDescriptionDescriptionShort TitleShort TitleAction ScopesAction ScopesOn NotificationOn Notification<html><head/><body><p>If not empty, this will enable provider notification listening and the action will be executed when the notification message matched the specified value. </p></body></html><html><head/><body><p>If not empty, this will enable provider notification listening and the action will be executed when the notification message matched the specified value. </p></body></html>Only when editableOnly when editableAdd a new actionAdd a new actionShow in Attribute TableShow in Attribute TableLayoutLayoutSeparate ButtonsSeparate ButtonsCombo BoxCombo BoxActionActionAction ListAction ListCreate Default ActionsCreate Default ActionsCaptureCaptureRemove the selected actionRemove the selected actionMove the selected action upMove the selected action upMove the selected action downMove the selected action downQgsAttributeActionPropertiesDialogSelect an actionFile dialog window titleSelect an actionImages( %1 ); All( *.* )Images( %1 ); All( *.* )Choose Icon…Choose Icon…Additional variablesAdditional variablesQgsAttributeActionPropertiesDialogBaseFormFormInserts the selected field into the actionInserts the selected field into the actionInsertInsertBrowse for actionBrowse for actionClick to browse for an actionClick to browse for an actionClicking the button will let you select an application to use as the actionClicking the button will let you select an application to use as the action<html><head/><body><p>The action text defines what happens if the action is triggered.<br/>The content depends on the type.<br/>For the type <span style=" font-style:italic;">Python</span> the content should be python code<br/>For other types it should be a file or application with optional parameters</p></body></html><html><head/><body><p>The action text defines what happens if the action is triggered.<br/>The content depends on the type.<br/>For the type <span style=" font-style:italic;">Python</span> the content should be python code<br/>For other types it should be a file or application with optional parameters</p></body></html>TypeTypeDescriptionDescriptionIconIconShort NameShort NameGenericGenericEnter the name of an action here. The name should be unique (QGIS will make it unique if necessary).Enter the name of an action here. The name should be unique (QGIS will make it unique if necessary).……Execute if notification matchesExecute if notification matchesAction TextAction Text<html><head/><body><p>If specified, listen to data source notification and performs action if notification message matches the specified value.</p><p>E.g. to match message beginning with <span style=" font-weight:600;">whatever </span>use <span style=" font-weight:600;">^whatever</span></p></body></html><html><head/><body><p>If specified, listen to data source notification and performs action if notification message matches the specified value.</p><p>E.g. to match message beginning with <span style=" font-weight:600;">whatever </span>use <span style=" font-weight:600;">^whatever</span></p></body></html>Enable only when editableEnable only when editablePythonPythonMacMacWindowsWindowsUnixUnixOpenOpenAction ScopesAction ScopesCaptures any output from the actionCaptures any output from the actionCaptures the standard output or error generated by the action and displays it in a dialog boxCaptures the standard output or error generated by the action and displays it in a dialog boxCapture outputCapture outputEnter the action name hereEnter the action name hereMandatory descriptionMandatory descriptionLeave empty to use only iconLeave empty to use only iconQgsAttributeDialog%1 - Feature Attributes%1 - Feature AttributesQgsAttributeFormAttributes changedAttributes changedApply changes to edited features?Apply changes to edited features?%1 matching %2 selected%1 matching %2 selectedfeaturefeaturefeaturesfeaturesNo matching features foundNo matching features foundUpdated multiple feature attributesUpdated multiple feature attributesUnsaved multiedit changes: <a href="#apply">apply changes</a> or <a href="#reset">reset changes</a>.Unsaved multiedit changes: <a href="#apply">apply changes</a> or <a href="#reset">reset changes</a>.Select FeaturesSelect FeaturesAdd to Current SelectionAdd to Current SelectionRemove from Current SelectionRemove from Current SelectionFilter Current SelectionFilter Current SelectionFilter Within ("AND")Filter Within ("AND")Extend Filter ("OR")Extend Filter ("OR")The python init function (<code>%1</code>) does not accept three arguments as expected!<br>Please check the function name in the <b>Fields</b> tab of the layer properties.The python init function (<code>%1</code>) does not accept three arguments as expected!<br>Please check the function name in the <b>Fields</b> tab of the layer properties.No feature joinedNo feature joinedJoin settings do not allow editingJoin settings do not allow editingJoin settings do not allow upsert on editJoin settings do not allow upsert on editJoined layer is not toggled editableJoined layer is not toggled editable&Reset form&Reset form&Select features&Select featuresMultiedit AttributesMultiedit AttributesEdits will be applied to all selected features.Edits will be applied to all selected features.Attribute changes for multiple features applied.Attribute changes for multiple features applied.Changes could not be applied.Changes could not be applied.Failed to create widget with type '%1'Failed to create widget with type '%1'&Flash features&Flash features&Zoom to features&Zoom to featuresFilter featuresFilter featuresCloseCloseThe python init function (<code>%1</code>) could not be found!<br>Please check the function name in the <b>Fields</b> tab of the layer properties.The python init function (<code>%1</code>) could not be found!<br>Please check the function name in the <b>Fields</b> tab of the layer properties.QgsAttributeLoadValuesLoad Values from LayerLoad Values from LayerLayerLayerDescriptionDescriptionValueValueSelect data from attributes in selected layer.Select data from attributes in selected layer.View AllView AllInsert NULL value on topInsert NULL value on topQgsAttributeRelationEditFormFormRelationRelationCardinalityCardinalityFor a many to many (N:M) relation, the direct link has to be selected. The in-between table will be hidden.For a many to many (N:M) relation, the direct link has to be selected. The in-between table will be hidden.QgsAttributeTableDelegateAttribute changedAttribute changedQgsAttributeTableDialogAttribute TableAttribute TableInvert selection (Ctrl+R)Invert selection (Ctrl+R)Ctrl+SCtrl+SCopy selected rows to clipboard (Ctrl+C)Copy selected rows to clipboard (Ctrl+C)Ctrl+CCtrl+CZoom map to the selected rows (Ctrl+J)Zoom map to the selected rows (Ctrl+J)Ctrl+JCtrl+JPan map to the selected rows (Ctrl+P)Pan map to the selected rows (Ctrl+P)Ctrl+PCtrl+PToggle editing mode (Ctrl+E)Toggle editing mode (Ctrl+E)Ctrl+ECtrl+EReload the tableReload the tableSelect features using an expressionSelect features using an expressionDeselect all (Ctrl+Shift+A)Deselect all (Ctrl+Shift+A)Ctrl+Shift+ACtrl+Shift+ASelect all (Ctrl+A)Select all (Ctrl+A)Toggle multi edit modeToggle multi edit modeCtrl+ACtrl+ASelect/filter features using form (Ctrl+F)Select/filter features using form (Ctrl+F)Paste features from clipboard (Ctrl+V)Paste features from clipboard (Ctrl+V)Ctrl+VCtrl+VNew fieldNew fieldCtrl+WCtrl+WFilterFilterFilters the visible features according to the current filter selection and filter string.Filters the visible features according to the current filter selection and filter string.ApplyApplyTable ViewTable View==Update AllUpdate AllAdvanced Filter (Expression)Advanced Filter (Expression)Use the Expression Builder to define the filterUse the Expression Builder to define the filterSelect/filter features using formSelect/filter features using formCtrl+FCtrl+FShow All FeaturesShow All FeaturesShow Selected FeaturesShow Selected FeaturesField FilterField FilterShow Edited and New FeaturesShow Edited and New FeaturesShow Features Visible On MapShow Features Visible On MapDelete field (Ctrl+L)Delete field (Ctrl+L)New field (Ctrl+W)New field (Ctrl+W)The filter defines which features are currently shown in the list or on the tableThe filter defines which features are currently shown in the list or on the tableSwitch to form viewSwitch to form viewForm ViewForm ViewSwitch to table viewSwitch to table viewFilter all the features which have been edited but not yet savedFilter all the features which have been edited but not yet savedToggle editing modeToggle editing modeSave editsSave editsSave edits (Ctrl+S)Save edits (Ctrl+S)Delete selected featuresDelete selected featuresDelDelSelect allSelect allInvert selectionInvert selectionDeselect allDeselect allMove selection to topMove selection to topPan map to the selected rowsPan map to the selected rowsZoom map to the selected rowsZoom map to the selected rowsCut selected rows to clipboardCut selected rows to clipboardCut selected rows to clipboard (Ctrl+X)Cut selected rows to clipboard (Ctrl+X)Ctrl+XCtrl+XCopy selected rows to clipboardCopy selected rows to clipboardPaste features from clipboardPaste features from clipboardDelete fieldDelete fieldCtrl+LCtrl+LConditional formattingConditional formattingDock Attribute TableDock Attribute TableActionsActionsAdd featureAdd featureOpen field calculatorOpen field calculatorOpen field calculator (Ctrl+I)Open field calculator (Ctrl+I)Ctrl+ICtrl+I %1 :: Features Total: %2, Filtered: %3, Selected: %4 %1 :: Features Total: %2, Filtered: %3, Selected: %4An error occurred while trying to update the field %1An error occurred while trying to update the field %1An error occurred while evaluating the calculation string:
%1An error occurred while evaluating the calculation string:
%1Update AttributesUpdate AttributesExpression Based FilterExpression Based FilterFailed to add field '%1' of type '%2'. Is the field name unique?Failed to add field '%1' of type '%2'. Is the field name unique?Parsing errorParsing errorEvaluation errorEvaluation errorDelete featureDelete featureUpdate FilteredUpdate FilteredMultiedit is not supported when using custom UI formsMultiedit is not supported when using custom UI formsSearch is not supported when using custom UI formsSearch is not supported when using custom UI formsCalculating fieldCalculating fieldAttribute addedAttribute addedAdd FieldAdd FieldDeleted attributeDeleted attributeThe attribute(s) could not be deletedThe attribute(s) could not be deletedAttribute errorAttribute errorError filteringError filteringGeometryless feature addedGeometryless feature addedUpdate SelectedUpdate SelectedCtrl+RCtrl+RQgsAttributeTableFilterModelActionsActionsQgsAttributeTableModelextra columnextra columnFeature ID: %1Feature ID: %1QgsAttributeTableViewSelect AllSelect AllQgsAttributeTypeDialogEdit Widget PropertiesEdit Widget PropertiesGeneralGeneralAliasAliasCommentCommentEditableEditableLabel on topLabel on topWidget TypeWidget TypeConstraintsConstraintsUniqueUniqueNot nullNot null<p>Enforcing the unique constraint prevents committing features which do not meet the constraint.</p><p>Unenforced constraints display a warning to users, but do not prevent committing the feature.</p><p>Enforcing the unique constraint prevents committing features which do not meet the constraint.</p><p>Unenforced constraints display a warning to users, but do not prevent committing the feature.</p>Enforce unique constraintEnforce unique constraintExpression descriptionExpression descriptionOptional descriptive name for expression constraintOptional descriptive name for expression constraint<p>Enforcing the not null constraint prevents committing features which do not meet the constraint.</p><p>Unenforced constraints display a warning to users, but do not prevent committing the feature.</p><p>Enforcing the not null constraint prevents committing features which do not meet the constraint.</p><p>Unenforced constraints display a warning to users, but do not prevent committing the feature.</p>Enforce not null constraintEnforce not null constraintExpressionExpression<p>Enforcing the expression constraint prevents committing features which do not meet the constraint.</p><p>Unenforced constraints display a warning to users, but do not prevent committing the feature.</p><p>Enforcing the expression constraint prevents committing features which do not meet the constraint.</p><p>Unenforced constraints display a warning to users, but do not prevent committing the feature.</p>Enforce expression constraintEnforce expression constraintDefaultsDefaultsDefault valueDefault valuePreviewPreview<p>With this option checked, the default value will not only be used when the feature is first created, but also whenever a feature's attribute or geometry is changed.</p><p>This is often useful for a last_modified timestamp or to record the username that last modified the feature.</p><p>With this option checked, the default value will not only be used when the feature is first created, but also whenever a feature's attribute or geometry is changed.</p><p>This is often useful for a last_modified timestamp or to record the username that last modified the feature.</p>Apply default value on updateApply default value on updateThe provider for this layer has a NOT NULL constraint set on the field.The provider for this layer has a NOT NULL constraint set on the field.The provider for this layer has a UNIQUE constraint set on the field.The provider for this layer has a UNIQUE constraint set on the field.QgsAttributesFormInitCodePython Init Code ConfigurationPython Init Code ConfigurationThe function code of the function can be loaded from the source code entered
in this dialog, from an external python file or from the environment (for example
from a plugin or from startup.py).
An example is:
from qgis.PyQt.QtWidgets import QWidget
def my_form_open(dialog, layer, feature):
geom = feature.geometry()
control = dialog.findChild(QWidget,"MyLineEdit")
Reference in function name: my_form_open
The function code of the function can be loaded from the source code entered
in this dialog, from an external python file or from the environment (for example
from a plugin or from startup.py).
An example is:
from qgis.PyQt.QtWidgets import QWidget
def my_form_open(dialog, layer, feature):
geom = feature.geometry()
control = dialog.findChild(QWidget,"MyLineEdit")
Reference in function name: my_form_open
Python Init functionPython Init functionThe function code of the function can be loaded from the source code entered
in this dialog, from an external python file or from the environment (for example
from a plugin or from startup.py).
An example is:
from qgis.PyQt.QtWidgets import QWidget
def my_form_open(dialog, layer, feature):
geom = feature.geometry()
control = dialog.findChild(QWidget,"MyLineEdit")
Reference in function name: my_form_open
The function code of the function can be loaded from the source code entered
in this dialog, from an external python file or from the environment (for example
from a plugin or from startup.py).
An example is:
from qgis.PyQt.QtWidgets import QWidget
def my_form_open(dialog, layer, feature):
geom = feature.geometry()
control = dialog.findChild(QWidget,"MyLineEdit")
Reference in function name: my_form_open
External fileExternal fileFunction nameFunction nameEnter the name of the form init function.Enter the name of the form init function.Load from external fileLoad from external fileProvide code in this dialogProvide code in this dialogLoad from the environmentLoad from the environmentSelect Python FileSelect Python FilePython files (*.py *.PY)Python files (*.py *.PY)QgsAttributesFormPropertiesFormFormSelect attribute layout editorSelect attribute layout editorAutogenerateAutogenerateDrag and drop designerDrag and drop designerProvide ui-fileProvide ui-fileQGIS forms can have a Python function that is called when the form is opened.
Use this function to add extra logic to your forms.QGIS forms can have a Python function that is called when the form is opened.
Use this function to add extra logic to your forms.......Edit UIEdit UIAvailable WidgetsAvailable WidgetsForm LayoutForm Layout%1 (%2)%1 (%2)RelationsRelationsOther WidgetsOther WidgetsQML WidgetQML WidgetHide form on add feature (global settings)Hide form on add feature (global settings)Show form on add feature (global settings)Show form on add feature (global settings)Hide form on add featureHide form on add featureShow form on add featureShow form on add feature# -*- coding: utf-8 -*-
"""
QGIS forms can have a Python function that is called when the form is
opened.
Use this function to add extra logic to your forms.
Enter the name of the function in the "Python Init function"
field.
An example follows:
"""
from qgis.PyQt.QtWidgets import QWidget
def my_form_open(dialog, layer, feature):
geom = feature.geometry()
control = dialog.findChild(QWidget, "MyLineEdit")
# -*- coding: utf-8 -*-
"""
QGIS forms can have a Python function that is called when the form is
opened.
Use this function to add extra logic to your forms.
Enter the name of the function in the "Python Init function"
field.
An example follows:
"""
from qgis.PyQt.QtWidgets import QWidget
def my_form_open(dialog, layer, feature):
geom = feature.geometry()
control = dialog.findChild(QWidget, "MyLineEdit")
Many to one relationMany to one relationSelect edit formSelect edit formUI fileUI fileQgsAuthAuthoritiesEditorCertificate Authorities EditorCertificate Authorities EditorCertificate Authorities and Issuers <i>(Root/File certificates are read-only)</i>Certificate Authorities and Issuers <i>(Root/File certificates are read-only)</i>Certificates fileCertificates fileFile of concatenated CAs and/or IssuersFile of concatenated CAs and/or Issuers……Import certificate(s) to authentication databaseImport certificate(s) to authentication databaseRemove certificate from authentication databaseRemove certificate from authentication databaseShow information for certificateShow information for certificateGroup by organizationGroup by organizationRefresh certificate tree viewRefresh certificate tree viewCommon NameCommon NameSerial #Serial #Expiry DateExpiry DateTrust PolicyTrust PolicyERROR storing CA(s) in authentication databaseERROR storing CA(s) in authentication databaseCertificate id missingCertificate id missingRemove Certificate AuthorityRemove Certificate AuthorityAre you sure you want to remove the selected Certificate Authority from the database?
Operation can NOT be undone!Are you sure you want to remove the selected Certificate Authority from the database?
Operation can NOT be undone!Certificate could not be found in database for id %1:Certificate could not be found in database for id %1:ERROR removing cert(s) trust policy from authentication database.ERROR removing cert(s) trust policy from authentication database.ERROR removing CA from authentication database for id %1:ERROR removing CA from authentication database for id %1:ERROR removing cert trust policy from authentication database for id %1:ERROR removing cert trust policy from authentication database for id %1:Default Trust PolicyDefault Trust PolicyChanging the default certificate authority trust policy to 'Untrusted' can cause unexpected SSL network connection results.Changing the default certificate authority trust policy to 'Untrusted' can cause unexpected SSL network connection results.Default policyDefault policyQgsAuthBasicEditOptionalOptionalRequiredRequiredRealmRealmShowShowUsernameUsernamePasswordPasswordQgsAuthBasicMethodBasic authenticationBasic authenticationQgsAuthCertInfoCertificate InfoCertificate InfoCertificate HierarchyCertificate HierarchyTextLabelTextLabelCertificate InformationCertificate InformationTrust policyTrust policySave certificate trust policy change to databaseSave certificate trust policy change to databaseSaveSave<b>Setup ERROR:</b>
<b>Setup ERROR:</b>
Could not populate QCA certificate collectionCould not populate QCA certificate collectionCould not set QCA certificateCould not set QCA certificateInvalid population of QCA certificate chain.<br><br>Validity message: %1Invalid population of QCA certificate chain.<br><br>Validity message: %1Missing CAMissing CAFieldFieldValueValueGeneralGeneralDetailsDetailsSubject InfoSubject InfoIssuer InfoIssuer InfoPublic Key InfoPublic Key InfoExtensionsExtensionsPEM TextPEM TextTypeTypeMissing CA (incomplete local CA chain)Missing CA (incomplete local CA chain)self-signedself-signedRootRootUsage typeUsage typeSubjectSubjectIssuerIssuerNot valid afterNot valid afterPublic keyPublic keySignature algorithmSignature algorithmCountry (C)Country (C)State/Province (ST)State/Province (ST)Locality (L)Locality (L)Organization (O)Organization (O)Organizational unit (OU)Organizational unit (OU)Common name (CN)Common name (CN)Email address (E)Email address (E)Distinguished nameDistinguished nameEmail LegacyEmail LegacyIncorporation CountryIncorporation CountryIncorporation State/ProvinceIncorporation State/ProvinceIncorporation LocalityIncorporation LocalityURIURIDNSDNSIP AddressIP AddressXMPPXMPPEmail: Email: DNS: DNS: Alternate namesAlternate namesVersionVersionSerial #Serial #Not valid beforeNot valid beforeMD5 fingerprintMD5 fingerprintSHA1 fingerprintSHA1 fingerprintCRL locationsCRL locationsIssuer locationsIssuer locationsOCSP locationsOCSP locationsAlgorithmAlgorithmKey sizeKey sizeExponentExponentVerifyVerifyEncryptEncryptDecryptDecryptKey agreementKey agreementExportExportKey usageKey usageCertificate Authority: %1Certificate Authority: %1YesYesNoNoChain Path Limit: %1Chain Path Limit: %1Basic constraintsBasic constraintsExtended key usageExtended key usageSubject key IDSubject key IDAuthority key IDAuthority key IDQgsAuthCertInfoDialogCertificate InformationCertificate InformationQgsAuthCertManagerAuthentication Certificate EditorsAuthentication Certificate EditorsIdentitiesIdentitiesServersServersAuthoritiesAuthoritiesNote: Editing writes directly to authentication databaseNote: Editing writes directly to authentication databaseCertificate ManagerCertificate ManagerQgsAuthConfigEditAuthenticationAuthenticationClearClearOptional URL resourceOptional URL resourceNote: Saving writes directly to authentication databaseNote: Saving writes directly to authentication databaseRequiredRequiredIdIdResourceResourceNameNameAuthentication config id not loaded: %1Authentication config id not loaded: %1QgsAuthConfigEditorEdit Authentication ConfigurationsEdit Authentication ConfigurationsAdd new authentication configurationAdd new authentication configurationRemove selected authentication configurationRemove selected authentication configurationEdit selected authentication configurationEdit selected authentication configurationAuthentication ConfigurationsAuthentication ConfigurationsIDIDNameNameURIURITypeTypeVersionVersionConfigConfigRemove ConfigurationRemove ConfigurationAre you sure you want to remove '%1'?
Operation can NOT be undone!Are you sure you want to remove '%1'?
Operation can NOT be undone!QgsAuthConfigIdEditFormFormGeneratedGenerated<html><head/><body><p>Unlock to edit the ID</p><p><span style=" font-style:italic;">7-character alphanumeric only</span></p><p><span style=" font-weight:600; color:#a80b0a;">Editing may break things!</span></p></body></html><html><head/><body><p>Unlock to edit the ID</p><p><span style=" font-style:italic;">7-character alphanumeric only</span></p><p><span style=" font-weight:600; color:#a80b0a;">Editing may break things!</span></p></body></html>……QgsAuthConfigSelectAuthentication ConfigurationAuthentication ConfigurationEdit selected configurationEdit selected configurationDelete selected configurationDelete selected configurationDeleteDeleteDismissDismissCreate a new authentication configurationCreate a new authentication configurationNewNewEditEditAuthentication config id not loaded: %1Authentication config id not loaded: %1Missing authentication method descriptionMissing authentication method description<ul><li><b>Method type:</b> %1</li><li><b>Configuration ID:</b> %2</li></ul><ul><li><b>Method type:</b> %1</li><li><b>Configuration ID:</b> %2</li></ul>Configuration '%1' not in databaseConfiguration '%1' not in databaseNo authenticationNo authenticationRemove AuthenticationRemove AuthenticationAre you sure that you want to permanently remove this configuration right now?
Operation can NOT be undone!Are you sure that you want to permanently remove this configuration right now?
Operation can NOT be undone!QgsAuthConfigUriEditDialogDialogEdit Authentication Configuration IDEdit Authentication Configuration IDNote: Button actions above affect authentication databaseNote: Button actions above affect authentication databaseAuthentication Config ID String EditorAuthentication Config ID String EditorNo authcfg in Data Source URINo authcfg in Data Source URIAdding authcfg to URI not supportedAdding authcfg to URI not supportedQgsAuthEditorWidgetsInput master passwordInput master passwordClear cached master passwordClear cached master passwordReset master passwordReset master passwordClear cached authentication configurationsClear cached authentication configurationsRemove all authentication configurationsRemove all authentication configurationsErase authentication databaseErase authentication databaseClear network authentication access cacheClear network authentication access cacheAutomatically clear network authentication access cache on SSL errorsAutomatically clear network authentication access cache on SSL errorsStore/update the master password in your %1Store/update the master password in your %1Clear the master password from your %1Clear the master password from your %1Integrate master password with your %1Integrate master password with your %1Enable password helper debug logEnable password helper debug logAuth cache clearedAuth cache clearedNetwork authentication cache has been clearedNetwork authentication cache has been clearedQgsAuthEditorsAuthentication EditorsAuthentication EditorsConfigurationsConfigurationsManagementManagementInstalled PluginsInstalled PluginsManage CertificatesManage CertificatesUtilitiesUtilitiesNote: Editing writes directly to authentication databaseNote: Editing writes directly to authentication databaseQgsAuthEsriTokenEditTokenTokenRequiredRequiredQgsAuthEsriTokenMethodESRI token based authenticationESRI token based authenticationQgsAuthIdentCertEditIdentityIdentitySelect identity…Select identity…Organization not definedOrganization not definedQgsAuthIdentCertMethodPKI stored identity certificatePKI stored identity certificateQgsAuthIdentitiesEditorIdentity Certificates EditorIdentity Certificates EditorUser Identity BundlesUser Identity BundlesImport identity bundle to authentication databaseImport identity bundle to authentication databaseRemove identity bundle from authentication databaseRemove identity bundle from authentication databaseShow information for bundleShow information for bundleGroup by organizationGroup by organization……Refresh identity bundle tree viewRefresh identity bundle tree viewCommon NameCommon NameSerial #Serial #Expiry DateExpiry DateCertificate BundlesCertificate BundlesERROR storing identity bundle in authentication database.ERROR storing identity bundle in authentication database.Certificate id missing.Certificate id missing.Remove Certificate IdentityRemove Certificate IdentityAre you sure you want to remove the selected certificate identity from the database?
Operation can NOT be undone!Are you sure you want to remove the selected certificate identity from the database?
Operation can NOT be undone!ERROR removing cert identity from authentication database for id %1:ERROR removing cert identity from authentication database for id %1:QgsAuthImportCertDialogImport Certificate(s)Import Certificate(s)PEM/DER-formatted PEM/DER-formatted ……Import(s) can contain multiple certificatesImport(s) can contain multiple certificatesPEM textPEM textFileFileTrust policyTrust policyValidation ResultsValidation ResultsAllow invalid certificatesAllow invalid certificatesImport Certificate AuthoritiesImport Certificate AuthoritiesImportImportCertificates found: %1
Certificates valid: %2Certificates found: %1
Certificates valid: %2
Authorities/Issuers: %1%2
Authorities/Issuers: %1%2Open Certificate FileOpen Certificate FileAll files (*.*);;PEM (*.pem);;DER (*.der)All files (*.*);;PEM (*.pem);;DER (*.der)QgsAuthImportIdentityDialogImport IdentityImport IdentityKeyKeyCertCertRequiredRequired……Validation ResultsValidation ResultsOptional passphraseOptional passphraseShowShowBundleBundlePKI PEM/DER Certificate PathsPKI PEM/DER Certificate PathsPKI PKCS#12 Certificate BundlePKI PKCS#12 Certificate BundleValid: %1Valid: %1Invalid: %1Invalid: %1Open Client Certificate FileOpen Client Certificate FileAll files (*.*);;PEM (*.pem);;DER (*.der)All files (*.*);;PEM (*.pem);;DER (*.der)Open Private Key FileOpen Private Key FileOpen PKCS#12 Certificate BundleOpen PKCS#12 Certificate BundlePKCS#12 (*.p12 *.pfx)PKCS#12 (*.p12 *.pfx)Missing componentsMissing componentsFailed to read client certificate from fileFailed to read client certificate from fileFailed to load client certificate from fileFailed to load client certificate from fileExtra certificates found with identityExtra certificates found with identity%1 thru %2%1 thru %2Failed to load client private key from fileFailed to load client private key from filePrivate key password may not matchPrivate key password may not matchQCA library has no PKCS#12 supportQCA library has no PKCS#12 supportFailed to read bundle fileFailed to read bundle fileIncorrect bundle passwordIncorrect bundle passwordFailed to decode (try entering password)Failed to decode (try entering password)Bundle empty or can not be loadedBundle empty or can not be loadedBundle client cert can not be loadedBundle client cert can not be loadedQt cert could not be created from QCA certQt cert could not be created from QCA certQt private key could not be created from QCA keyQt private key could not be created from QCA keyFile not foundFile not foundQgsAuthManagerOpening of authentication db FAILEDOpening of authentication db FAILEDQCA's OpenSSL plugin (qca-ossl) is missingQCA's OpenSSL plugin (qca-ossl) is missingNo authentication method plugins foundNo authentication method plugins foundNo authentication method plugins could be loadedNo authentication method plugins could be loadedAuth db directory path could not be createdAuth db directory path could not be createdAuth db is not readable or writable by userAuth db is not readable or writable by userAuth db could not be created and openedAuth db could not be created and openedAuthentication system is DISABLED:
%1Authentication system is DISABLED:
%1Master password set: FAILED to verify, reset to previousMaster password set: FAILED to verify, reset to previousMaster password: FAILED to access databaseMaster password: FAILED to access databaseMaster password: FAILED to find just one master password record in databaseMaster password: FAILED to find just one master password record in databaseMaster password: FAILED to verify against hash in databaseMaster password: FAILED to verify against hash in databaseMaster password: failed 5 times authentication system DISABLEDMaster password: failed 5 times authentication system DISABLEDMaster password: hash FAILED to be stored in databaseMaster password: hash FAILED to be stored in databaseMaster password reset FAILED: could not clear current password from databaseMaster password reset FAILED: could not clear current password from databaseMaster password reset FAILED: could not store new password in databaseMaster password reset FAILED: could not store new password in databaseMaster password reset FAILED: could not verify new password in databaseMaster password reset FAILED: could not verify new password in databaseMaster password reset FAILED: could not re-encrypt configs in databaseMaster password reset FAILED: could not re-encrypt configs in databaseMaster password reset FAILED: could not verify password can decrypt re-encrypted configsMaster password reset FAILED: could not verify password can decrypt re-encrypted configsMaster password reset FAILED: could not re-encrypt settings in databaseMaster password reset FAILED: could not re-encrypt settings in databaseMaster password reset FAILED: could not re-encrypt identities in databaseMaster password reset FAILED: could not re-encrypt identities in databaseMaster password reset: could not remove old database backupMaster password reset: could not remove old database backupConfig ID is emptyConfig ID is emptyStore config: FAILED because config is invalidStore config: FAILED because config is invalidStore config: FAILED because pre-defined config ID is not uniqueStore config: FAILED because pre-defined config ID is not uniqueStore config: FAILED because config string is emptyStore config: FAILED because config string is emptyUpdate config: FAILED because config is invalidUpdate config: FAILED because config is invalidUpdate config: FAILED because config is emptyUpdate config: FAILED because config is emptyUpdate config: FAILED to prepare queryUpdate config: FAILED to prepare queryAuthentication database contains duplicate configuration IDsAuthentication database contains duplicate configuration IDsNo authentication database foundNo authentication database foundCould not back up authentication databaseCould not back up authentication databaseAuthentication database could not be deletedAuthentication database could not be deletedAuthentication database could not be initializedAuthentication database could not be initializedFAILED to create auth database config tablesFAILED to create auth database config tablesFAILED to create auth database cert tablesFAILED to create auth database cert tablesAuthentication database contains duplicate settingsAuthentication database contains duplicate settingsAuthentication database contains duplicate certificate identityAuthentication database contains duplicate certificate identityRetrieve certificate identity bundle: FAILED to create private keyRetrieve certificate identity bundle: FAILED to create private keyRetrieve certificate identity bundle: FAILED to create certificateRetrieve certificate identity bundle: FAILED to create certificateAuthentication database contains duplicate certificate bundlesAuthentication database contains duplicate certificate bundlesAuthentication database contains duplicate SSL cert custom configs for host:port, id: %1, %2Authentication database contains duplicate SSL cert custom configs for host:port, id: %1, %2Authentication database contains duplicate SSL cert custom configs for host:port: %1Authentication database contains duplicate SSL cert custom configs for host:port: %1Authentication database contains duplicate certificate authoritiesAuthentication database contains duplicate certificate authoritiesAuthentication database contains duplicate cert trust policiesAuthentication database contains duplicate cert trust policiesPassword HelperPassword HelperOpening %1 for DELETE…Opening %1 for DELETE…Opening %1 for READ…Opening %1 for READ…Opening %1 for WRITE…Opening %1 for WRITE…Delete password failed: %1.Delete password failed: %1.Retrieving password from your %1 failed: %2.Retrieving password from your %1 failed: %2.Empty password retrieved from your %1.Empty password retrieved from your %1.Storing password in your %1 failed: %2.Storing password in your %1 failed: %2.Your %1 will be <b>used from now</b> on to store and retrieve the master password.Your %1 will be <b>used from now</b> on to store and retrieve the master password.Your %1 will <b>not be used anymore</b> to store and retrieve the master password.Your %1 will <b>not be used anymore</b> to store and retrieve the master password.There was an error and integration with your %1 system has been disabled. You can re-enable it at any time through the "Utilities" menu in the Authentication pane of the options dialog. %2There was an error and integration with your %1 system has been disabled. You can re-enable it at any time through the "Utilities" menu in the Authentication pane of the options dialog. %2Error in %1: %2Error in %1: %2Master password has been successfully read from your %1Master password has been successfully read from your %1Master password stored in your %1 is not validMaster password stored in your %1 is not validMaster password has been successfully written to your %1Master password has been successfully written to your %1Master password could not be written to your %1Master password could not be written to your %1Authentication database contains duplicate setting keysAuthentication database contains duplicate setting keysAuthentication database contains duplicate identity IDsAuthentication database contains duplicate identity IDsUnable to establish authentication database connectionUnable to establish authentication database connectionAuth db query exec() FAILEDAuth db query exec() FAILEDAuth db query FAILEDAuth db query FAILEDAuth db FAILED to start transactionAuth db FAILED to start transactionAuth db FAILED to rollback changesAuth db FAILED to rollback changesQgsAuthMethodPluginsDialogDialogInstalled authentication method pluginsInstalled authentication method pluginsMethodMethodDescriptionDescriptionWorks withWorks withQgsAuthOAuth2ConfigCustomCustomPredefinedPredefinedAuthorization CodeAuthorization CodeImplicitImplicitResource OwnerResource OwnerHeaderHeaderForm (POST only)Form (POST only)URL QueryURL QueryQgsAuthOAuth2EditConfigureConfigureGrant FlowGrant FlowExport configurationExport configuration......Import configurationImport configurationScopeScopeRequest TimeoutRequest TimeoutRedirect URLRedirect URLAuthorization-related timeoutAuthorization-related timeout seconds secondsDescriptionDescriptionOptionalOptionalAPI KeyAPI KeyRequiredRequiredRequest URLRequest URLOptional (space delimiter)Optional (space delimiter)Access MethodAccess MethodUsernameUsernameAdvancedAdvancedPasswordPasswordResource access token methodResource access token methodPersist between launchesPersist between launchesToken URLToken URLClient SecretClient SecretClient IDClient IDToken SessionToken SessionRefresh Token URLRefresh Token URLhttp://127.0.0.1:http://127.0.0.1:Port numberPort number//SubdirectorySubdirectoryDefinedDefinedDefined configurations are JSON-formatted files, with a single configuration per file. This allows configurations to be swapped out via filesystem tools without affecting user configurations. It is recommended to use the Configure tab’s export function, then edit the resulting file. See QGIS documentation for further details.Defined configurations are JSON-formatted files, with a single configuration per file. This allows configurations to be swapped out via filesystem tools without affecting user configurations. It is recommended to use the Configure tab’s export function, then edit the resulting file. See QGIS documentation for further details.Add extra config directory to parseAdd extra config directory to parseSoftware StatementSoftware StatementConfiguration UrlConfiguration UrlRegisterRegisterExtra initial request parametersExtra initial request parametersKeyKeyValue (unencoded)Value (unencoded)TokensTokensRemove cached tokensRemove cached tokensSelect extra directory to parseSelect extra directory to parseSelect software statement fileSelect software statement fileJSON Web Token (*.jwt)JSON Web Token (*.jwt)ID: %1
Grant flow: %2
Description: %3ID: %1
Grant flow: %2
Description: %3No predefined configurations found on diskNo predefined configurations found on diskSave OAuth2 Config FileSave OAuth2 Config FileSelect OAuth2 Config FileSelect OAuth2 Config FileDownloading configuration failed with error: %1Downloading configuration failed with error: %1Configurations files can be placed in the directories:Configurations files can be placed in the directories:Configuration files can be placed in the directories:
%1Configuration files can be placed in the directories:
%1QgsAuthOAuth2MethodOAuth2 authenticationOAuth2 authenticationAuthenticator linking (login) has failedAuthenticator linking (login) has failedLinking succeeded, but authenticator access FAILED: null objectLinking succeeded, but authenticator access FAILED: null objectLinking apparently succeeded, but authenticator FAILED to verify it is linkedLinking apparently succeeded, but authenticator FAILED to verify it is linkedLinking succeededLinking succeededOpen browser requestedOpen browser requestedClose browser requestedClose browser requestedNetwork reply finishedNetwork reply finishedResults: %1Results: %1Network error but no reply object accessibleNetwork error but no reply object accessibleNetwork error: %1Network error: %1Network error, HTTP status: %1Network error, HTTP status: %1Attempting token refresh...Attempting token refresh...Token refresh FAILED: authcfg emptyToken refresh FAILED: authcfg emptyBackground token refresh underway for authcfg: %1Background token refresh underway for authcfg: %1Background token refresh FAILED for authcfg %1: could not get authenticator objectBackground token refresh FAILED for authcfg %1: could not get authenticator objectToken refresh error: %1Token refresh error: %1QgsAuthPkcs12EditOptional passphraseOptional passphraseShowShowRequiredRequiredBundleBundle……CAsCAsKeyKeyAdd bundle CAs to the connectionAdd bundle CAs to the connectionAddAddAdd also root (self-signed) CAAdd also root (self-signed) CARootRootMissing componentsMissing componentsQCA library has no PKCS#12 supportQCA library has no PKCS#12 supportFailed to read bundle fileFailed to read bundle fileIncorrect bundle passwordIncorrect bundle passwordFailed to decode (try entering password)Failed to decode (try entering password)Bundle empty or can not be loadedBundle empty or can not be loadedBundle client cert can not be loadedBundle client cert can not be loaded%1 thru %2%1 thru %2Valid: %1Valid: %1Invalid: %1Invalid: %1Open PKCS#12 Certificate BundleOpen PKCS#12 Certificate BundlePKCS#12 (*.p12 *.pfx)PKCS#12 (*.p12 *.pfx)<ul><li>Serial #: %1</li><li>Expiry date: %2</li></ul><ul><li>Serial #: %1</li><li>Expiry date: %2</li></ul>QgsAuthPkcs12MethodPKI PKCS#12 authenticationPKI PKCS#12 authenticationQgsAuthPkiPathsEditRequiredRequiredCAsCAsOptional passphraseOptional passphrase……ShowShowAdd bundle CAs to the connectionAdd bundle CAs to the connectionAddAddAdd also root (self-signed) CAAdd also root (self-signed) CARootRootKeyKeyCertCertMissing componentsMissing componentsFailed to load certificate from fileFailed to load certificate from file%1 thru %2%1 thru %2Valid: %1Valid: %1Invalid: %1Invalid: %1Open Client Certificate FileOpen Client Certificate FileAll files (*.*);;PEM (*.pem);;DER (*.der)All files (*.*);;PEM (*.pem);;DER (*.der)<ul><li>Serial #: %1</li><li>Expiry date: %2</li></ul><ul><li>Serial #: %1</li><li>Expiry date: %2</li></ul>Open Private Key FileOpen Private Key FileQgsAuthPkiPathsMethodPKI paths authenticationPKI paths authenticationQgsAuthServersEditorServer Exceptions/SSL Configs EditorServer Exceptions/SSL Configs EditorServer Certificate Exceptions and SSL ConfigurationsServer Certificate Exceptions and SSL ConfigurationsAdd new server certificate configurationAdd new server certificate configurationRemove selected server certificate configurationRemove selected server certificate configurationEdit selected server certificate configurationEdit selected server certificate configurationGroup by organizationGroup by organization……Common NameCommon NameHostHostExpiry DateExpiry DateSSL Server ConfigurationsSSL Server ConfigurationsSSL custom config id missingSSL custom config id missingSSL custom config host:port missingSSL custom config host:port missingRemove SSL Custom ConfigurationRemove SSL Custom ConfigurationAre you sure you want to remove the selected SSL custom configuration from the database?
Operation can NOT be undone!Are you sure you want to remove the selected SSL custom configuration from the database?
Operation can NOT be undone!ERROR removing SSL custom config from authentication database for host:port, id %1:ERROR removing SSL custom config from authentication database for host:port, id %1:SSL custom config id missing.SSL custom config id missing.SSL custom config host:port missing.SSL custom config host:port missing.QgsAuthSettingsWidgetFormFormConfigurationsConfigurationsChoose or create an authentication configurationChoose or create an authentication configurationConfigurations store encrypted credentials in the QGIS authentication database.Configurations store encrypted credentials in the QGIS authentication database.BasicBasicConvert to configurationConvert to configurationStoreStoreWarning text!Warning text!OptionalOptionalPasswor&dPasswor&d&User name&User name<div>Warning: credentials stored as plain text in %1.</div><div>Warning: credentials stored as plain text in %1.</div>project fileproject fileuser settingsuser settingsConverted config %1Converted config %1Couldn't create a Basic authentication configuration!Couldn't create a Basic authentication configuration!QgsAuthSslConfigDialogCustom Certificate ConfigurationCustom Certificate ConfigurationQgsAuthSslConfigWidgetFormFormCertificateCertificateNameNamehost:port (required)host:port (required)Show information for certificateShow information for certificate??ServerServerCustom SSL configurationCustom SSL configurationFieldFieldProtocolProtocolPeer verificationPeer verificationVerify peer certsVerify peer certsDo not verify peer certsDo not verify peer certsPeer verification depth (0 = complete cert chain)Peer verification depth (0 = complete cert chain)Ignore errorsIgnore errorsQgsAuthSslErrorsDialogCustom Certificate ConfigurationCustom Certificate ConfigurationSSL Errors occurred accessing URL:SSL Errors occurred accessing URL:SSL ErrorsSSL ErrorsShow information for certificate chainShow information for certificate chainConnection certificatesConnection certificatesConnection trusted CAsConnection trusted CAsSave SSL server e&xceptionSave SSL server e&xceptionWARNING: Only save SSL configurations when necessary.WARNING: Only save SSL configurations when necessary.QgsAuthSslImportDialogConnected to %1: %2Connected to %1: %2Socket CONNECTEDSocket CONNECTEDSocket DISCONNECTEDSocket DISCONNECTEDSocket ENCRYPTEDSocket ENCRYPTEDProtocolProtocolSession cipherSession cipherSocket ERRORSocket ERRORSocket unavailable or not encryptedSocket unavailable or not encryptedOpen Server Certificate FileOpen Server Certificate FileAll files (*.*);;PEM (*.pem);;DER (*.der)All files (*.*);;PEM (*.pem);;DER (*.der)Could not load any certs from fileCould not load any certs from fileCould not load server cert from fileCould not load server cert from fileCertificate does not appear for be for an SSL server. You can still add a configuration, if you know it is the correct certificate.Certificate does not appear for be for an SSL server. You can still add a configuration, if you know it is the correct certificate.QgsAuthSslTestDialogCustom Certificate ConfigurationCustom Certificate Configuration<html><head/><body><p>Save a custom SSL server configuration, importing certificate from server or file. WARNING: Only save configurations when necessary.</p></body></html><html><head/><body><p>Save a custom SSL server configuration, importing certificate from server or file. WARNING: Only save configurations when necessary.</p></body></html>Import CertificateImport CertificateFrom serverFrom serverhttps://https://www.example.comwww.example.com::ConnectConnectTimeoutTimeout sec secFrom fileFrom filePEM/DER formatted filePEM/DER formatted file……QgsAuthTrustedCAsDialogTrusted Certificate AuthoritiesTrusted Certificate AuthoritiesTrusted Certificate Authorities/Issuers (used in secure connections)Trusted Certificate Authorities/Issuers (used in secure connections)……Group by organizationGroup by organizationCommon NameCommon NameSerial #Serial #Expiry DateExpiry DateAuthorities/IssuersAuthorities/IssuersQgsBlendModeComboBoxNormalNormalLightenLightenScreenScreenDodgeDodgeAdditionAdditionDarkenDarkenMultiplyMultiplyBurnBurnOverlayOverlaySoft lightSoft lightHard lightHard lightDifferenceDifferenceSubtractSubtractQgsBlurWidgetStack blur (fast)Stack blur (fast)Gaussian blur (quality)Gaussian blur (quality)QgsBookmarkLocatorFilterSpatial BookmarksSpatial BookmarksQgsBookmarksImport/Export BookmarksImport/Export BookmarksUnable to open bookmarks database.
Database: %1
Driver: %2
Database: %3Unable to open bookmarks database.
Database: %1
Driver: %2
Database: %3IDIDNameNameProjectProjectxMinxMinyMinyMinxMaxxMaxyMaxyMaxSRIDSRIDNew bookmarkNew bookmarkAdd BookmarkAdd BookmarkExport BookmarksExport BookmarksXML files (*.xml *.XML)XML files (*.xml *.XML)Are you sure you want to delete %n bookmark(s)?number of rowsAre you sure you want to delete %n bookmark(s)?Are you sure you want to delete %n bookmark(s)?Reprojected extent is empty.Reprojected extent is empty.&Export&Export&Import&ImportSpatial BookmarksSpatial BookmarksDelete BookmarksDelete BookmarksEmpty ExtentEmpty ExtentImport BookmarksImport BookmarksUnable to create the bookmark.
Driver: %1
Database: %2Unable to create the bookmark.
Driver: %1
Database: %2QgsBookmarksBaseSpatial BookmarksSpatial BookmarksAddAddAdd bookmarkAdd bookmarkDeleteDeleteDelete bookmarkDelete bookmarkZoom toZoom toZoom to bookmarkZoom to bookmarkQgsBrowserDirectoryPropertiesBasePathPathQgsBrowserDockWidgetType here to filter visible items…Type here to filter visible items…Case SensitiveCase SensitiveFilter Pattern SyntaxFilter Pattern SyntaxNormalNormalWildcard(s)Wildcard(s)Regular ExpressionRegular Expressionfavorite “%1”favorite “%1”Rename FavoriteRename FavoriteAdd as a FavoriteAdd as a FavoriteRename Favorite…Rename Favorite…Remove FavoriteRemove FavoriteProperties…Properties…Add a Directory…Add a Directory…Add directory to favoritesAdd directory to favoritesHide from BrowserHide from BrowserFast Scan this DirectoryFast Scan this DirectoryAdd Selected Layer(s) to CanvasAdd Selected Layer(s) to CanvasQgsBrowserDockWidgetBaseBrowserBrowserRefreshRefreshAdd LayersAdd LayersAdd Selected LayersAdd Selected LayersFilter BrowserFilter BrowserShow PropertiesShow PropertiesEnable/disable properties widgetEnable/disable properties widgetCollapse AllCollapse AllOptionsOptionsQgsBrowserLayerPropertiesErrorErrorQgsBrowserLayerPropertiesBaseNameNamenamenameURIURIProviderProviderprovider keyprovider keyMetadataMetadatanoticenoticeQgsBrowserModelProject HomeProject HomeHomeHomeFavoritesFavoritesQgsBrowserPropertiesDialogLayer PropertiesLayer PropertiesDirectory PropertiesDirectory PropertiesQgsBrowserPropertiesDialogBaseDialogDialogQgsBrushStyleComboBoxSolidSolidNo BrushNo BrushHorizontalHorizontalVerticalVerticalCrossCrossBDiagonalBDiagonalFDiagonalFDiagonalDiagonal XDiagonal XDense 1Dense 1Dense 2Dense 2Dense 3Dense 3Dense 4Dense 4Dense 5Dense 5Dense 6Dense 6Dense 7Dense 7QgsBusyIndicatorDialogQGISQGISQgsCalendarConfigDlgBaseFormFormA calendar widget to enter a date.A calendar widget to enter a date.Date formatDate format<html><head/><body><p>Example formats:</p><table border="0" style=" margin-top:0px; margin-bottom:0px; margin-left:0px; margin-right:0px;" cellspacing="2" cellpadding="0" bgcolor="#f6f6f6"><thead><tr><td style=" vertical-align:top; padding-left:10; padding-right:15; padding-top:5; padding-bottom:5;"><p align="center"><span style=" font-family:'Open Sans,sans-serif'; font-size:12px; font-weight:600; color:#363534;">Format</span></p></td><td style=" vertical-align:top; padding-left:10; padding-right:15; padding-top:5; padding-bottom:5;"><p align="center"><span style=" font-family:'Open Sans,sans-serif'; font-size:12px; font-weight:600; color:#363534;">Result</span></p></td></tr></thead><tr><td bgcolor="#f6f6f6" style=" vertical-align:top; padding-left:10; padding-right:10; padding-top:3; padding-bottom:3;"><p><span style=" font-family:'Open Sans,sans-serif'; font-size:11px; color:#66666e; background-color:#f6f6f6;">dd.MM.yyyy</span></p></td><td bgcolor="#f6f6f6" style=" vertical-align:top; padding-left:10; padding-right:10; padding-top:3; padding-bottom:3;"><p><span style=" font-family:'Open Sans,sans-serif'; font-size:11px; color:#66666e; background-color:#f6f6f6;">21.05.2001</span></p></td></tr><tr><td bgcolor="#ffffff" style=" vertical-align:top; padding-left:10; padding-right:10; padding-top:3; padding-bottom:3;"><p><span style=" font-family:'Open Sans,sans-serif'; font-size:11px; color:#66666e; background-color:#ffffff;">ddd MMMM d yy</span></p></td><td bgcolor="#ffffff" style=" vertical-align:top; padding-left:10; padding-right:10; padding-top:3; padding-bottom:3;"><p><span style=" font-family:'Open Sans,sans-serif'; font-size:11px; color:#66666e; background-color:#ffffff;">Tue May 21 01</span></p></td></tr><tr><td bgcolor="#f6f6f6" style=" vertical-align:top; padding-left:10; padding-right:10; padding-top:3; padding-bottom:3;"><p><span style=" font-family:'Open Sans,sans-serif'; font-size:11px; color:#66666e; background-color:#f6f6f6;">hh:mm:ss.zzz</span></p></td><td bgcolor="#f6f6f6" style=" vertical-align:top; padding-left:10; padding-right:10; padding-top:3; padding-bottom:3;"><p><span style=" font-family:'Open Sans,sans-serif'; font-size:11px; color:#66666e; background-color:#f6f6f6;">14:13:09.042</span></p></td></tr><tr><td bgcolor="#ffffff" style=" vertical-align:top; padding-left:10; padding-right:10; padding-top:3; padding-bottom:3;"><p><span style=" font-family:'Open Sans,sans-serif'; font-size:11px; color:#66666e; background-color:#ffffff;">h:m:s ap</span></p></td><td bgcolor="#ffffff" style=" vertical-align:top; padding-left:10; padding-right:10; padding-top:3; padding-bottom:3;"><p><span style=" font-family:'Open Sans,sans-serif'; font-size:11px; color:#66666e; background-color:#ffffff;">2:13:9 pm</span></p></td></tr></table><p><a href="http://qt-project.org/doc/qt-5.0/qtcore/qdatetime.html#toString"><span style=" text-decoration: underline; color:#0000ff;">Reference documentation</span></a></p></body></html><html><head/><body><p>Example formats:</p><table border="0" style=" margin-top:0px; margin-bottom:0px; margin-left:0px; margin-right:0px;" cellspacing="2" cellpadding="0" bgcolor="#f6f6f6"><thead><tr><td style=" vertical-align:top; padding-left:10; padding-right:15; padding-top:5; padding-bottom:5;"><p align="center"><span style=" font-family:'Open Sans,sans-serif'; font-size:12px; font-weight:600; color:#363534;">Format</span></p></td><td style=" vertical-align:top; padding-left:10; padding-right:15; padding-top:5; padding-bottom:5;"><p align="center"><span style=" font-family:'Open Sans,sans-serif'; font-size:12px; font-weight:600; color:#363534;">Result</span></p></td></tr></thead><tr><td bgcolor="#f6f6f6" style=" vertical-align:top; padding-left:10; padding-right:10; padding-top:3; padding-bottom:3;"><p><span style=" font-family:'Open Sans,sans-serif'; font-size:11px; color:#66666e; background-color:#f6f6f6;">dd.MM.yyyy</span></p></td><td bgcolor="#f6f6f6" style=" vertical-align:top; padding-left:10; padding-right:10; padding-top:3; padding-bottom:3;"><p><span style=" font-family:'Open Sans,sans-serif'; font-size:11px; color:#66666e; background-color:#f6f6f6;">21.05.2001</span></p></td></tr><tr><td bgcolor="#ffffff" style=" vertical-align:top; padding-left:10; padding-right:10; padding-top:3; padding-bottom:3;"><p><span style=" font-family:'Open Sans,sans-serif'; font-size:11px; color:#66666e; background-color:#ffffff;">ddd MMMM d yy</span></p></td><td bgcolor="#ffffff" style=" vertical-align:top; padding-left:10; padding-right:10; padding-top:3; padding-bottom:3;"><p><span style=" font-family:'Open Sans,sans-serif'; font-size:11px; color:#66666e; background-color:#ffffff;">Tue May 21 01</span></p></td></tr><tr><td bgcolor="#f6f6f6" style=" vertical-align:top; padding-left:10; padding-right:10; padding-top:3; padding-bottom:3;"><p><span style=" font-family:'Open Sans,sans-serif'; font-size:11px; color:#66666e; background-color:#f6f6f6;">hh:mm:ss.zzz</span></p></td><td bgcolor="#f6f6f6" style=" vertical-align:top; padding-left:10; padding-right:10; padding-top:3; padding-bottom:3;"><p><span style=" font-family:'Open Sans,sans-serif'; font-size:11px; color:#66666e; background-color:#f6f6f6;">14:13:09.042</span></p></td></tr><tr><td bgcolor="#ffffff" style=" vertical-align:top; padding-left:10; padding-right:10; padding-top:3; padding-bottom:3;"><p><span style=" font-family:'Open Sans,sans-serif'; font-size:11px; color:#66666e; background-color:#ffffff;">h:m:s ap</span></p></td><td bgcolor="#ffffff" style=" vertical-align:top; padding-left:10; padding-right:10; padding-top:3; padding-bottom:3;"><p><span style=" font-family:'Open Sans,sans-serif'; font-size:11px; color:#66666e; background-color:#ffffff;">2:13:9 pm</span></p></td></tr></table><p><a href="http://qt-project.org/doc/qt-5.0/qtcore/qdatetime.html#toString"><span style=" text-decoration: underline; color:#0000ff;">Reference documentation</span></a></p></body></html>QgsCategorizedSymbolRendererModelSymbolSymbolValueValueLegendLegendQgsCategorizedSymbolRendererWidgetColumnColumnSymbolSymbolChange...Change...Color rampColor rampClassifyClassifyAddAddDeleteDeleteDelete AllDelete AllAdvancedAdvancedMatch to Saved SymbolsMatch to Saved SymbolsMatch to Symbols from File…Match to Symbols from File…Symbol Levels…Symbol Levels…Data-defined Size Legend…Data-defined Size Legend…Classify CategoriesClassify CategoriesHigh number of classes. Classification would yield %1 entries which might not be expected. Continue?High number of classes. Classification would yield %1 entries which might not be expected. Continue?Delete ClassificationDelete ClassificationThe classification field was changed from '%1' to '%2'.
Should the existing classes be deleted before classification?The classification field was changed from '%1' to '%2'.
Should the existing classes be deleted before classification?Matched SymbolsMatched SymbolsMatched %1 categories to symbols.Matched %1 categories to symbols.No categories could be matched to symbols in library.No categories could be matched to symbols in library.Match to Symbols from FileMatch to Symbols from FileXML files (*.xml *.XML)XML files (*.xml *.XML)An error occurred while reading file:
%1An error occurred while reading file:
%1Matched %1 categories to symbols from file.Matched %1 categories to symbols from file.No categories could be matched to symbols in file.No categories could be matched to symbols in file.QgsCharacterSelectorBaseCharacter SelectorCharacter SelectorFontFontCurrent font family and styleCurrent font family and styleQgsCheckBoxConfigDlgBaseFormFormRepresentation for checked stateRepresentation for checked stateRepresentation for unchecked stateRepresentation for unchecked stateQgsCheckableComboBoxSelect AllSelect AllDeselect AllDeselect AllQgsCodeEditorCSSCSS EditorCSS EditorQgsCodeEditorExpressionExpression EditorExpression EditorQgsCodeEditorHTMLHTML EditorHTML EditorQgsCodeEditorPythonPython EditorPython EditorQgsCodeEditorSQLSQL EditorSQL EditorQgsCollapsibleGroupBoxBasicShift-click to expand, then collapse othersShift-click to expand, then collapse othersCtrl (or Alt)-click to toggle allCtrl (or Alt)-click to toggle allQgsCollapsibleGroupBoxPluginA collapsible group boxA collapsible group boxA collapsible group box with save state capabilityA collapsible group box with save state capabilityQgsColorBrewerColorRampDialogColorBrewer RampColorBrewer RampQgsColorBrewerColorRampWidgetBaseColorBrewer RampColorBrewer RampColorsColorsScheme nameScheme namePreviewPreviewQgsColorButtonSelect ColorSelect ColorNo colorNo colorClear ColorClear ColorDefault ColorDefault ColorCopy ColorCopy ColorPaste ColorPaste ColorPick ColorPick ColorChoose Color…Choose Color…QgsColorButtonPluginSelect colorSelect colorQgsColorDialogResetResetSelect ColorSelect ColorQgsColorDialogBaseColor PickerColor PickerImport Colors...Import Colors...Import colors from fileImport colors from fileExport Colors...Export Colors...Export colors to fileExport colors to filePaste ColorsPaste ColorsPaste colors from clipboardPaste colors from clipboardImport Palette...Import Palette...Import palette from fileImport palette from fileRemove PaletteRemove PaletteRemove current paletteRemove current paletteNew Palette...New Palette...Create a new paletteCreate a new paletteCopy ColorsCopy ColorsCopy selected colorsCopy selected colorsQgsColorEffectWidgetOffOffBy lightnessBy lightnessBy luminosityBy luminosityBy averageBy averageQgsColorRampButtonSelect Color RampSelect Color RampEdit RampEdit RampAll Color RampsAll Color RampsInvert Color RampInvert Color RampClear Current RampClear Current RampDefault Color RampDefault Color RampRandom Color RampRandom Color RampShuffle Random ColorsShuffle Random ColorsCreate New Color Ramp…Create New Color Ramp…Edit Color Ramp…Edit Color Ramp…Save Color Ramp…Save Color Ramp…GradientGradientCatalog: cpt-cityCatalog: cpt-cityColor presetsColor presetsRandomRandomCatalog: ColorBrewerCatalog: ColorBrewerColor ramp typeColor ramp typePlease select color ramp type:Please select color ramp type:Save Color RampSave Color RampColor ramp with name '%1' already exists. Overwrite?Color ramp with name '%1' already exists. Overwrite?QgsColorRampShaderWidgetOptionsOptionsChange Color…Change Color…Change Opacity…Change Opacity…DiscreteDiscreteLinearLinearExactExactContinuousContinuousEqual IntervalEqual IntervalQuantileQuantileLoad Color MapLoad Color MapThe color map for band %1 has no entries.The color map for band %1 has no entries.Load Color Map from FileLoad Color Map from FileTextfile (*.txt)Textfile (*.txt)The following lines contained errors
The following lines contained errors
Read access denied. Adjust the file permissions and try again.
Read access denied. Adjust the file permissions and try again.
Save Color Map as FileSave Color Map as FileQGIS Generated Color Map Export FileQGIS Generated Color Map Export FileWrite access denied. Adjust the file permissions and try again.
Write access denied. Adjust the file permissions and try again.
ValueValueValue for color stopValue for color stopValue <=Value <=Maximum value for classMaximum value for classValue =Value =Value for colorValue for colorOpacityOpacityChange color opacity [%]Change color opacity [%]QgsColorRampShaderWidgetBaseFormFormValueValueColorColorLabelLabelColor rampColor rampInterpolationInterpolationClassifyClassifyAdd values manuallyAdd values manuallyRemove selected row(s)Remove selected row(s)Load color map from bandLoad color map from bandLoad color map from fileLoad color map from fileExport color map to fileExport color map to fileIf checked, any pixels with a value out of range will not be renderedIf checked, any pixels with a value out of range will not be renderedClip out of range valuesClip out of range valuesModeModeClassesClassesUnit suffixUnit suffixLabel unit
suffixLabel unit
suffixQgsColorSchemeListSelect Palette FileSelect Palette FileImport ColorsImport ColorsError, file does not exist or is not readable.Error, file does not exist or is not readable.Error, no colors found in palette file.Error, no colors found in palette file.Palette filePalette fileExport ColorsExport ColorsError writing palette file.Error writing palette file.QgsColorSchemeModelColorColorLabelLabelQgsColorSliderWidget%%QgsColorSwatchDelegateSelect ColorSelect ColorSelect colorSelect colorQgsColorTextWidgetrgb( %1, %2, %3 )rgb( %1, %2, %3 )rgba( %1, %2, %3, %4 )rgba( %1, %2, %3, %4 )#RRGGBB#RRGGBB#RRGGBBAA#RRGGBBAArgb( r, g, b )rgb( r, g, b )rgba( r, g, b, a )rgba( r, g, b, a )QgsCompassPluginShow compassShow compass&About&AboutQgsCompassPluginGuiPixmap not foundPixmap not foundQgsCompassPluginGuiBaseInternal CompassInternal CompassAzimutAzimutQgsCompoundColorWidgetSelect Palette FileSelect Palette FileImport Color PaletteImport Color PaletteError, file does not exist or is not readable.Error, file does not exist or is not readable.Palette file is not readable.Palette file is not readable.No colors found in palette file.No colors found in palette file.Remove Color PaletteRemove Color PaletteAre you sure you want to remove %1?Are you sure you want to remove %1?Create New PaletteCreate New PaletteEnter a name for the new palette:Enter a name for the new palette:New paletteNew palettenew_palettenew_paletteQgsCompoundColorWidgetBaseHHSSVVRRGGBBOpacityOpacityHTML notationHTML notationColor rampColor rampColor wheelColor wheelColor swatchesColor swatches……Add current colorAdd current colorRemove selected colorRemove selected colorColor pickerColor pickerSample average radiusSample average radius px pxSample colorSample color<i>Press space to sample a color from under the mouse cursor</i><i>Press space to sample a color from under the mouse cursor</i>CurrentCurrentOldOldAdd color to swatchAdd color to swatchImport Colors...Import Colors...Import colors from fileImport colors from fileExport Colors...Export Colors...Export colors to fileExport colors to filePaste ColorsPaste ColorsPaste colors from clipboardPaste colors from clipboardImport Palette...Import Palette...Import palette from fileImport palette from fileRemove PaletteRemove PaletteRemove current paletteRemove current paletteNew Palette...New Palette...Create a new paletteCreate a new paletteCopy ColorsCopy ColorsCopy selected colorsCopy selected colorsShow in Color ButtonsShow in Color ButtonsQgsConfigCacheError when loading project file '%1': %2 Error when loading project file '%1': %2 QgsConfigureShortcutsDialogKeyboard ShortcutsKeyboard ShortcutsSearch...Search...ActionActionShortcutShortcutChangeChangeSet NoneSet NoneSet DefaultSet DefaultLoad...Load...Save...Save...XML fileXML fileAll filesAll filesCannot write file %1:
%2.Cannot write file %1:
%2.Save ShortcutsSave ShortcutsSaving ShortcutsSaving ShortcutsLoad ShortcutsLoad ShortcutsLoading ShortcutsLoading ShortcutsCannot read file %1:
%2.Cannot read file %1:
%2.Parse error at line %1, column %2:
%3Parse error at line %1, column %2:
%3The file is not an shortcuts exchange file.The file is not an shortcuts exchange file.The file contains shortcuts created with different locale, so you can't use it.The file contains shortcuts created with different locale, so you can't use it.NoneNoneSet default (%1)Set default (%1)Input: Input: Change ShortcutChange ShortcutThis shortcut is already assigned to action %1. Reassign?This shortcut is already assigned to action %1. Reassign?QgsCptCityBrowserModelNameNameInfoInfoQgsCptCityColorRampDialogError - cpt-city gradient files not found.
You have two means of installing them:
1) Install the "Color Ramp Manager" python plugin (you must enable Experimental plugins in the plugin manager) and use it to download latest cpt-city package.
You can install the entire cpt-city archive or a selection for QGIS.
2) Download the complete archive (in svg format) and unzip it to your QGIS settings directory [%1] .
This file can be found at [%2]
and current file is [%3]Error - cpt-city gradient files not found.
You have two means of installing them:
1) Install the "Color Ramp Manager" python plugin (you must enable Experimental plugins in the plugin manager) and use it to download latest cpt-city package.
You can install the entire cpt-city archive or a selection for QGIS.
2) Download the complete archive (in svg format) and unzip it to your QGIS settings directory [%1] .
This file can be found at [%2]
and current file is [%3]Selections by themeSelections by themeAll by authorAll by authorAll Ramps (%1)All Ramps (%1)%1 Directory Details%1 Directory Details%1 Gradient Details%1 Gradient DetailsYou can download a more complete set of cpt-city gradients by installing the "Color Ramp Manager" plugin (you must enable Experimental plugins in the plugin manager).
You can download a more complete set of cpt-city gradients by installing the "Color Ramp Manager" plugin (you must enable Experimental plugins in the plugin manager).
Download More Cpt-city GradientsDownload More Cpt-city GradientsQgsCptCityColorRampDialogBaseCpt-city Color RampCpt-city Color RampSelection and PreviewSelection and PreviewLicenseLicensePalettePalettePathPathInformationInformationAuthor(s)Author(s)SourceSourceDetailsDetailsSave as standard gradientSave as standard gradientQgsCptCityColorRampItemcolorscolorsdiscretediscretecontinuouscontinuouscontinuous (multi)continuous (multi)variantsvariantsQgsCrashDialogDialogDialogCopy ReportCopy ReportTell us something about when you got the crashTell us something about when you got the crashReport DetailsReport DetailsReload QGISReload QGISQuitQuitHeaderHeaderMessageMessageHelp MessageHelp MessageOh Uh!Oh Uh!:( QGIS Crashed:( QGIS CrashedSorry. It looks something unexpected happened that we didn't handle and QGIS crashed.Sorry. It looks something unexpected happened that we didn't handle and QGIS crashed.Keen to help us fix bugs? <a href="http://qgis.org/en/site/getinvolved/development/bugreporting.html#bugs-features-and-issues">Follow the steps to help our developers.</a><br><br>You can also send us a helpful bug report using the Copy Report button <br>and opening a ticket at <a href="https://issues.qgis.org/">issues.qgis.org</a>Keen to help us fix bugs? <a href="http://qgis.org/en/site/getinvolved/development/bugreporting.html#bugs-features-and-issues">Follow the steps to help our developers.</a><br><br>You can also send us a helpful bug report using the Copy Report button <br>and opening a ticket at <a href="https://issues.qgis.org/">issues.qgis.org</a>QgsCredentialDialogEnter CredentialsEnter CredentialsUsernameUsernamePasswordPasswordVerify passwordVerify passwordStore master password in your password managerStore master password in your password managerDo not forget it: NOT retrievable!Do not forget it: NOT retrievable!Saved for session, until app is quit.Saved for session, until app is quit.Password attempts: #Password attempts: #Erase authentication database?Erase authentication database?TextLabelTextLabelRealmRealmRequiredRequiredStore/update the master password in your %1Store/update the master password in your %1Enter CURRENT master authentication passwordEnter CURRENT master authentication passwordSet NEW master authentication passwordSet NEW master authentication passwordPassword attempts: %1Password attempts: %1QgsCustomLayerOrderWidgetControl rendering orderControl rendering orderQgsCustomProjectionDialogQGIS Custom ProjectionQGIS Custom ProjectionThis proj4 projection definition is not valid.This proj4 projection definition is not valid.new CRSnew CRSThe proj4 definition of '%1' is not valid.The proj4 definition of '%1' is not valid.Northing and Easthing must be in decimal form.Northing and Easthing must be in decimal form.Internal Error (source projection invalid?)Internal Error (source projection invalid?)ErrorErrorQgsCustomProjectionDialogBaseCustom Coordinate Reference System DefinitionCustom Coordinate Reference System DefinitionDefineDefineIDIDYou can define your own custom Coordinate Reference System (CRS) here. The definition must conform to the proj4 format for specifying a CRS.You can define your own custom Coordinate Reference System (CRS) here. The definition must conform to the proj4 format for specifying a CRS.NameNameParametersParametersCopy parameters from existing CRSCopy parameters from existing CRSTestTestUse the text boxes below to test the CRS definition you are creating. Enter a coordinate where both the lat/long and the transformed result are known (for example by reading off a map). Then press the calculate button to see if the CRS definition you are creating is accurate.Use the text boxes below to test the CRS definition you are creating. Enter a coordinate where both the lat/long and the transformed result are known (for example by reading off a map). Then press the calculate button to see if the CRS definition you are creating is accurate.Geographic / WGS84Geographic / WGS84Destination CRS Destination CRS NorthNorthEastEastAdd new CRSAdd new CRSCalculateCalculateRemove CRSRemove CRSQgsCustomizationDialogObject nameObject nameLabelLabelChoose a customization INI fileChoose a customization INI fileCustomization files (*.ini)Customization files (*.ini)QgsCustomizationDialogBaseInterface CustomizationInterface CustomizationEnable customizationEnable customizationtoolBartoolBarCatchCatchSwitch to catching widgets in main applicationSwitch to catching widgets in main applicationSaveSaveSave to fileSave to fileLoadLoadLoad from fileLoad from fileExpand AllExpand AllCollapse AllCollapse AllCheck AllCheck AllQgsDashSpaceDialogBaseDash Space PatternDash Space PatternDashDashSpaceSpaceQgsDataDefinedRotationDialogRotationRotationQgsDataDefinedSizeDialogSizeSizeQgsDataDefinedSizeLegendWidgetData-defined Size LegendData-defined Size LegendLegend not enabledLegend not enabledSeparated legend itemsSeparated legend itemsCollapsed legendCollapsed legendLegend Symbol...Legend Symbol...TitleTitleManual size classesManual size classesAdd a classAdd a class......Remove selected classRemove selected classOptions (collapsed only)Options (collapsed only)Align symbolsAlign symbolsBottomBottomCenterCenterValueValueLabelLabelAdd Size ClassAdd Size ClassEnter value for a new classEnter value for a new classQgsDataDefinedValueBaseDialogDialogDialog……LabelLabelQgsDataDefinedWidthDialogWidthWidthQgsDataSourceManagerDialogData Source ManagerData Source ManagerBrowserBrowserCannot get %1 select dialog from source select provider %2.Cannot get %1 select dialog from source select provider %2.Data Source Manager | %1Data Source Manager | %1Add %1 layerAdd %1 layerQgsDateTimeEditclearclearQgsDateTimeEditConfigFormFormDateDateTimeTimeDate timeDate timeISO date timeISO date timeQt ISO Date formatQt ISO Date formatISO 8601ISO 8601extended format: either <code>yyyy-MM-dd</code> for dates or <code>yyyy-MM-ddTHH:mm:ss</code> (e.g. 2017-07-24T15:46:29), or with a time-zone suffix (Z for UTC otherwise an offset as [+|-]HH:mm) where appropriate for combined dates and times.extended format: either <code>yyyy-MM-dd</code> for dates or <code>yyyy-MM-ddTHH:mm:ss</code> (e.g. 2017-07-24T15:46:29), or with a time-zone suffix (Z for UTC otherwise an offset as [+|-]HH:mm) where appropriate for combined dates and times.FormatFormatExamples resultExamples resultExpressionExpressionDate outputDate outputthe day as number without a leading zero (1 to 31)the day as number without a leading zero (1 to 31)the day as number with a leading zero (01 to 31)the day as number with a leading zero (01 to 31)the abbreviated localized day name (e.g. 'Mon' to 'Sun'). Uses the system locale to localize the name, i.e. the abbreviated localized day name (e.g. 'Mon' to 'Sun'). Uses the system locale to localize the name, i.e. the long localized day name (e.g. 'Monday' to 'the long localized day name (e.g. 'Monday' to 'Uses the system locale to localize the name, i.e. Uses the system locale to localize the name, i.e. the month as number without a leading zero (1-12)the month as number without a leading zero (1-12)the month as number with a leading zero (01-12)the month as number with a leading zero (01-12)the abbreviated localized month name (e.g. 'Jan' to 'Dec'). Uses the system locale to localize the name, i.e.the abbreviated localized month name (e.g. 'Jan' to 'Dec'). Uses the system locale to localize the name, i.e.the long localized month name (e.g. 'January' to 'December'). Uses the system locale to localize the name, i.e.the long localized month name (e.g. 'January' to 'December'). Uses the system locale to localize the name, i.e.the year as two digit number (00-99)the year as two digit number (00-99)the year as four digit numberthe year as four digit numberTime outputTime outputthe hour without a leading zero (0 to 23 or 1 to 12 if AM/PM display)the hour without a leading zero (0 to 23 or 1 to 12 if AM/PM display)the hour with a leading zero (00 to 23 or 01 to 12 if AM/PM display)the hour with a leading zero (00 to 23 or 01 to 12 if AM/PM display)the hour without a leading zero (0 to 23, even with AM/PM display)the hour without a leading zero (0 to 23, even with AM/PM display)the hour with a leading zero (00 to 23, even with AM/PM display)the hour with a leading zero (00 to 23, even with AM/PM display)the minute without a leading zero (0 to 59)the minute without a leading zero (0 to 59)the minute with a leading zero (00 to 59)the minute with a leading zero (00 to 59)the second without a leading zero (0 to 59)the second without a leading zero (0 to 59)the second with a leading zero (00 to 59)the second with a leading zero (00 to 59)the milliseconds without leading zeroes (0 to 999)the milliseconds without leading zeroes (0 to 999)the milliseconds with leading zeroes (000 to 999)the milliseconds with leading zeroes (000 to 999)use AM/PM display.use AM/PM display.will be replaced by eitherwill be replaced by eitherororuse am/pm display.use am/pm display.will be replaced by either will be replaced by either the timezone (for example "CEST")the timezone (for example "CEST")Field FormatField Format……Widget DisplayWidget DisplayDefaultDefaultCustomCustomCalendar popupCalendar popupAllow NULL valuesAllow NULL valuesPreviewPreviewQgsDateTimeEditPluginDefine dateDefine dateQgsDateTimeEditWrapperDate/time edit widget could not be initialized because provided widget is not a QDateTimeEdit.Date/time edit widget could not be initialized because provided widget is not a QDateTimeEdit.UI formsUI formsThe usual date/time widget QDateTimeEdit cannot be configured to allow NULL values. For that the QGIS custom widget QgsDateTimeEdit needs to be used.The usual date/time widget QDateTimeEdit cannot be configured to allow NULL values. For that the QGIS custom widget QgsDateTimeEdit needs to be used.field widgetsfield widgetsQgsDatumTransformDialogSource transformSource transformDestination transformDestination transformFile '%1' not found in directory '%2'File '%1' not found in directory '%2'QgsDatumTransformDialogBaseSelect Datum TransformationsSelect Datum TransformationsHide deprecatedHide deprecatedDestination CRSDestination CRSSource CRSSource CRSQgsDatumTransformTableModelSource CRSSource CRSSource datum transformSource datum transformDestination CRSDestination CRSDestination datum transformDestination datum transformQgsDatumTransformTableWidgetBaseFormForm......QgsDb2ConnectionItemDB2 Spatial Extender is not enabled or set up.DB2 Spatial Extender is not enabled or set up.Refresh ConnectionRefresh ConnectionEdit Connection…Edit Connection…Delete ConnectionDelete Connection%1: Not a valid layer!%1: Not a valid layer!%1: Not a vector layer!%1: Not a vector layer!Import to DB2 databaseImport to DB2 databaseFailed to import some layers!
Failed to import some layers!
Import was successful.Import was successful.QgsDb2NewConnectionSaving PasswordsSaving PasswordsWARNING: You have opted to save your password. It will be stored in plain text in your project files and in your home directory on Unix-like systems, or in your user profile on Windows. If you do not want this to happen, please press the Cancel button.
WARNING: You have opted to save your password. It will be stored in plain text in your project files and in your home directory on Unix-like systems, or in your user profile on Windows. If you do not want this to happen, please press the Cancel button.
Save ConnectionSave ConnectionError: %1.Error: %1.Connection to %1 was successful.Connection to %1 was successful.Connection failed: %1.Connection failed: %1.Should the existing connection %1 be overwritten?Should the existing connection %1 be overwritten?QgsDb2NewConnectionBaseConnection InformationConnection InformationDriverDriverHostHostPortPort&Test Connection&Test ConnectionDatabaseDatabaseCreate a New DB2 ConnectionCreate a New DB2 ConnectionNameNameService/DSNService/DSNAuthenticationAuthenticationQgsDb2Provider8 Bytes integer8 Bytes integer4 Bytes integer4 Bytes integer2 Bytes integer2 Bytes integerDecimal number (numeric)Decimal number (numeric)Decimal number (decimal)Decimal number (decimal)Decimal number (real)Decimal number (real)Decimal number (double)Decimal number (double)DateDateTimeTimeDate & TimeDate & TimeText, fixed length (char)Text, fixed length (char)Text, variable length (varchar)Text, variable length (varchar)Text, variable length large object (clob)Text, variable length large object (clob)Text, variable length large object (dbclob)Text, variable length large object (dbclob)QgsDb2RootItemNew Connection…New Connection…QgsDb2SchemaItemDB2 *** %1 as %2 in %3DB2 *** %1 as %2 in %3as geometryless tableas geometryless tableQgsDb2SourceSelectAdd Db2 Table(s)Add Db2 Table(s)&Set Filter&Set FilterSet FilterSet FilterWildcardWildcardRegExpRegExpAllAllSchemaSchemaTableTableTypeTypeGeometry columnGeometry columnPrimary key columnPrimary key columnSRIDSRIDSqlSqlAre you sure you want to remove the %1 connection and all associated settings?Are you sure you want to remove the %1 connection and all associated settings?Confirm DeleteConfirm DeleteLoad ConnectionsLoad ConnectionsXML files (*.xml *.XML)XML files (*.xml *.XML)Select TableSelect TableYou must select a table in order to add a layer.You must select a table in order to add a layer.DB2 ProviderDB2 ProviderDB2GSE.ST_GEOMETRY_COLUMNS Not FoundDB2GSE.ST_GEOMETRY_COLUMNS Not FoundDB2GSE.ST_GEOMETRY_COLUMNS not found. The DB2 Spatial Extender is not enabled or set up.DB2GSE.ST_GEOMETRY_COLUMNS not found. The DB2 Spatial Extender is not enabled or set up.StopStopConnectConnectQgsDb2SourceSelectDelegateSelect…Select…QgsDb2TableModelSchemaSchemaTableTableTypeTypeGeometry columnGeometry columnSRIDSRIDPrimary key columnPrimary key columnSelect at idSelect at idSqlSqlDetecting…Detecting…Select…Select…Enter…Enter…Disable 'Fast Access to Features at ID' capability to force keeping the attribute table in memory (e.g. in case of expensive views).Disable 'Fast Access to Features at ID' capability to force keeping the attribute table in memory (e.g. in case of expensive views).QgsDbSourceSelectBaseAdd PostGIS LayersAdd PostGIS LayersConnectionsConnectionsConnect to selected databaseConnect to selected databaseConnectConnectCreate a new database connectionCreate a new database connectionNewNewEdit selected database connectionEdit selected database connectionEditEditRemove connection to selected databaseRemove connection to selected databaseRemoveRemoveLoadLoad connections from fileLoadSave connections to fileSave connections to fileSaveSaveAlso list tables with no geometryAlso list tables with no geometryKeep dialog openKeep dialog openSearch optionsSearch optionsSearchSearchSearch modeSearch modeSearch in columnsSearch in columnsQgsDecorationCopyrightDialogCopyright Label DecorationCopyright Label Decoration&Placement&PlacementMargin from edgeMargin from edgeHorizontalHorizontalEnable Copyright LabelEnable Copyright LabelCopyright label textCopyright label textVerticalVerticalInsert an Expression...Insert an Expression...FontFontTop leftTop leftTop rightTop rightBottom leftBottom leftBottom rightBottom rightCopyright Label Text FormatCopyright Label Text FormatQgsDecorationGridNo active layerNo active layerGet Interval from LayerGet Interval from LayerPlease select a raster layer.Please select a raster layer.Layer CRS must be equal to project CRS.Layer CRS must be equal to project CRS.Invalid raster layerInvalid raster layerQgsDecorationGridDialogInterval XInterval XInterval YInterval YGrid PropertiesGrid PropertiesEnable GridEnable GridDraw AnnotationDraw AnnotationGrid typeGrid typeLine symbolLine symbolAnnotation directionAnnotation directionDistance to map frameDistance to map frameCoordinate precisionCoordinate precisionFontFontMarker symbolMarker symbolOffset XOffset XOffset YOffset YUpdate Interval / Offset fromUpdate Interval / Offset fromCanvas ExtentsCanvas ExtentsActive Raster LayerActive Raster LayerLineLineMarkerMarkerHorizontalHorizontalVerticalVerticalBoundary directionBoundary directionHorizontal and VerticalHorizontal and VerticalQgsDecorationLayoutExtent%1: %2%1: %2QgsDecorationLayoutExtentDialogLayout Extents PropertiesLayout Extents PropertiesShow Layout ExtentsShow Layout ExtentsFontFontSymbolSymbolLabel extentsLabel extentsQgsDecorationNorthArrowDialogNorth Arrow DecorationNorth Arrow DecorationSizeSize mm mmCustom SVGCustom SVG……ColorColorFillFillHorizontalHorizontalVerticalVerticalAutomaticAutomaticPreview of north arrowPreview of north arrowAngleAngleEnable North ArrowEnable North ArrowStrokeStrokePlacementPlacementMargin from edgeMargin from edgePlacement on screenPlacement on screenTop leftTop leftTop rightTop rightBottom leftBottom leftBottom rightBottom rightSelect SVG fileSelect SVG fileSelect North Arrow Fill ColorSelect North Arrow Fill ColorSelect North Arrow Outline ColorSelect North Arrow Outline ColorFile not foundFile not foundPixmap not foundPixmap not foundQgsDecorationScaleBarTick DownTick DownTick UpTick UpBarBarBoxBoxkmkmmmmmcmcmmmmilesmilesmilemileinchesinchesfootfootfeetfeetdegreedegreedegreesdegreesQgsDecorationScaleBarDialogScale Bar DecorationScale Bar DecorationScale bar styleScale bar styleSelect the style of the scale barSelect the style of the scale barMargin from edgeMargin from edgeTick DownTick DownEnable Scale BarEnable Scale BarFillFillOutlineOutlineTick UpTick UpBoxBoxBarBarFont of barFont of barFontFontHorizontalHorizontalVerticalVerticalColor of barColor of barSize of barSize of barPlacementPlacementAutomatically snap to round number on resizeAutomatically snap to round number on resize meters/km meters/km feet/miles feet/miles degrees degreesTop leftTop leftTop rightTop rightBottom leftBottom leftBottom rightBottom rightSelect Scale Bar Fill ColorSelect Scale Bar Fill ColorSelect Scale Bar Outline ColorSelect Scale Bar Outline ColorQgsDefaultRasterLayerLegendfollowing %1 items
not displayedfollowing %1 items
not displayedQgsDelAttrDialogBaseDelete FieldsDelete FieldsProvider fields can only be deleted when the layer is in edit mode.Provider fields can only be deleted when the layer is in edit mode.Provider does not support deleting fields.Provider does not support deleting fields.QgsDelimitedTextProviderFile type string in %1 is not correctly formattedFile type string in %1 is not correctly formattedFile cannot be opened or delimiter parameters are not validFile cannot be opened or delimiter parameters are not valid%0 field %1 is not defined in delimited text file%0 field %1 is not defined in delimited text fileInvalid record format at line %1Invalid record format at line %1Invalid WKT at line %1Invalid WKT at line %1Invalid X or Y fields at line %1Invalid X or Y fields at line %1%1 records discarded due to invalid format%1 records discarded due to invalid format%1 records have missing geometry definitions%1 records have missing geometry definitions%1 records discarded due to invalid geometry definitions%1 records discarded due to invalid geometry definitions%1 records discarded due to incompatible geometry types%1 records discarded due to incompatible geometry typesErrors in file %1Errors in file %1The following lines were not loaded into QGIS due to errors:The following lines were not loaded into QGIS due to errors:There are %1 additional errors in the fileThere are %1 additional errors in the fileDelimited text file errorsDelimited text file errorsInvalid subset string %1 for %2Invalid subset string %1 for %2The file has been updated by another application - reloadingThe file has been updated by another application - reloadingWhole number (integer)Whole number (integer)Decimal number (double)Decimal number (double)Text, unlimited length (text)Text, unlimited length (text)Whole number (integer - 64 bit)Whole number (integer - 64 bit)QgsDelimitedTextSourceSelectNo layer nameNo layer namePlease enter a layer name before adding the layer to the mapPlease enter a layer name before adding the layer to the mapNo delimiters setNo delimiters setUse one or more characters as the delimiter, or choose a different delimiter typeUse one or more characters as the delimiter, or choose a different delimiter typeInvalid regular expressionInvalid regular expressionPlease enter a valid regular expression as the delimiter, or choose a different delimiter typePlease enter a valid regular expression as the delimiter, or choose a different delimiter typeInvalid delimited text fileInvalid delimited text filePlease enter a valid file and delimiterPlease enter a valid file and delimiterChoose a Delimited Text File to OpenChoose a Delimited Text File to OpenText filesText filesPlease select an input filePlease select an input fileFile %1 does not existFile %1 does not existPlease enter a layer namePlease enter a layer nameAt least one delimiter character must be specifiedAt least one delimiter character must be specifiedRegular expression is not validRegular expression is not valid^.. expression needs capture groups^.. expression needs capture groupsDefinition of filename and delimiters is not validDefinition of filename and delimiters is not validNo data found in fileNo data found in file%1 badly formatted records discarded%1 badly formatted records discardedX and Y field names must be selectedX and Y field names must be selectedX and Y field names cannot be the sameX and Y field names cannot be the sameThe WKT field name must be selectedThe WKT field name must be selectedThe CRS must be selectedThe CRS must be selected%1 badly formatted records discarded from sample data%1 badly formatted records discarded from sample dataAll filesAll filesQgsDelimitedTextSourceSelectBaseCreate a Layer from a Delimited Text FileCreate a Layer from a Delimited Text FileLayer nameLayer nameName to display in the map legendName to display in the map legendName displayed in the map legendName displayed in the map legendField names are read from the first record. If not selected then fields are numberedField names are read from the first record. If not selected then fields are numberedThe file is a comma separated value file, fields delimited by commas and quoted by "The file is a comma separated value file, fields delimited by commas and quoted by "Each line in the file is split using a regular expression to define the end of each fieldEach line in the file is split using a regular expression to define the end of each fieldTabTabSpaceSpaceCommaCommaFile nameFile nameEncodingEncodingSelect the file encodingSelect the file encodingRecord and Fields OptionsRecord and Fields OptionsX and Y coordinates are expressed in degrees/minutes/secondsX and Y coordinates are expressed in degrees/minutes/secondsDMS coordinatesDMS coordinatesGeometry fieldGeometry fieldName of the field containing well known text valueName of the field containing well known text valueGeometry typeGeometry typeDetectDetectPointPointLineLinePolygonPolygonNumber of header lines to discardNumber of header lines to discardThe number of lines to discard from the beginning of the fileThe number of lines to discard from the beginning of the fileFirst record has field namesFirst record has field namesCSV (comma separated values)CSV (comma separated values)File FormatFile FormatFields are defined by the specified delimiter, quote, and escape charactersFields are defined by the specified delimiter, quote, and escape charactersCustom delimitersCustom delimitersRegular expression delimiterRegular expression delimiterOthersOthersDetect field typesDetect field typesGeometry DefinitionGeometry DefinitionWell known text (WKT)Well known text (WKT)<p align="left">X field</p><p align="left">X field</p><p align="left">Y field</p><p align="left">Y field</p>Geometry CRSGeometry CRSLayer SettingsLayer SettingsUse a spatial index to improve performance of displaying and spatially selecting featuresUse a spatial index to improve performance of displaying and spatially selecting featuresUse spatial indexUse spatial indexUse an index to improve performance of subset filters (set in layer properties)Use an index to improve performance of subset filters (set in layer properties)Use subset indexUse subset indexWatch for changes to the file by other applications while QGIS is runningWatch for changes to the file by other applications while QGIS is runningWatch fileWatch fileSample DataSample DataGeometry is a point defined by X and Y coordinate fieldsGeometry is a point defined by X and Y coordinate fieldsPoint coordinatesPoint coordinatesGeometry is read as a well known text string from the selected fieldsGeometry is read as a well known text string from the selected fieldsThe file contains only attribute information - it will not be displayed on the mapThe file contains only attribute information - it will not be displayed on the mapNo geometry (attribute only table)No geometry (attribute only table)Trim leading and trailing spaces from fieldsTrim leading and trailing spaces from fieldsTrim fieldsTrim fieldsDiscard empty fields in each recordDiscard empty fields in each recordDiscard empty fieldsDiscard empty fieldsNumber fields use comma for a decimal separatorNumber fields use comma for a decimal separatorDecimal separator is commaDecimal separator is commaComma character is one of the delimitersComma character is one of the delimitersTab character is one of the delimitersTab character is one of the delimitersSpace character is one of the delimitersSpace character is one of the delimitersColon character is one of the delimitersColon character is one of the delimitersSemicolon character is one of the delimitersSemicolon character is one of the delimitersSemicolonSemicolonDelimiters to use when splitting fields in the text file. The delimiter can be more than one character. These characters are used in addition to the comma, tab, space, colon, and semicolon options.Delimiters to use when splitting fields in the text file. The delimiter can be more than one character. These characters are used in addition to the comma, tab, space, colon, and semicolon options.The escape character(s) force the next character to be treated as a normal character (that is not a delimiter, quote, or new line character). If the escape character is the same as a quote character, it only escapes itself and only within quotes.The escape character(s) force the next character to be treated as a normal character (that is not a delimiter, quote, or new line character). If the escape character is the same as a quote character, it only escapes itself and only within quotes.QuoteQuoteThe quote character(s) enclose fields which may include delimiters and new linesThe quote character(s) enclose fields which may include delimiters and new lines""EscapeEscapeExpressionExpressionRegular expression used to split each line into fieldsRegular expression used to split each line into fieldsSample dataSample dataColonColonName of the field containing x valuesName of the field containing x valuesName of the field containing y valuesName of the field containing y valuesQgsDetailedItemWidgetBaseFormFormHeading LabelHeading LabelDetail labelDetail labelCategory labelCategory labelQgsDiagramPropertiesPie chartPie chartNo diagramsNo diagramsText diagramText diagramHistogramHistogramSelect Background ColorSelect Background ColorSelect Pen ColorSelect Pen ColorHeightHeightx-heightx-heightAreaAreaDiameterDiameterDiagram PropertiesDiagram PropertiesExpression Based AttributeExpression Based AttributeTopTopTransparent BackgroundTransparent BackgroundTransparent StrokeTransparent StrokeRightRightBottomBottomLeftLeftThe diagram type '%1' is unknown. A default type is selected for you.The diagram type '%1' is unknown. A default type is selected for you.Bar length: Scale linearly, so that the following value matches the specified bar length:Bar length: Scale linearly, so that the following value matches the specified bar length:Bar lengthBar lengthSizeSizeScale linearly between 0 and the following attribute value / diagram size:Scale linearly between 0 and the following attribute value / diagram size:Diagrams: No attributes added.Diagrams: No attributes added.You did not add any attributes to this diagram layer. Please specify the attributes to visualize on the diagrams or disable diagrams.You did not add any attributes to this diagram layer. Please specify the attributes to visualize on the diagrams or disable diagrams.QgsDiagramPropertiesBaseLowLowHighHighBackground colorBackground colorLine colorLine colorLine widthLine widthBar widthBar widthScale dependent visibilityScale dependent visibilityShow all diagramsShow all diagramsSizeSizeFixed sizeFixed sizeSize unitsSize unitsAttributeAttributeOpacityOpacity……FontFontControls how diagrams are drawn on top of each other. Diagrams with a higher z-index are drawn above diagrams and labels with a lower z-index.Controls how diagrams are drawn on top of each other. Diagrams with a higher z-index are drawn above diagrams and labels with a lower z-index.Always showAlways showDiscourage diagrams and labels from covering featuresDiscourage diagrams and labels from covering featuresShow diagramShow diagramControls whether specific diagrams should be shownControls whether specific diagrams should be shownControls whether specific diagrams should always be rendered, even when they overlap other diagrams or map labelsControls whether specific diagrams should always be rendered, even when they overlap other diagrams or map labelsAlways show all diagrams, even when they overlap with each other or other map labelsAlways show all diagrams, even when they overlap with each other or other map labelsScale linearly between 0 and the following attribute value / diagram sizeScale linearly between 0 and the following attribute value / diagram sizeScaleScaleIncrease size of small diagramsIncrease size of small diagramsMinimum sizeMinimum sizePlacementPlacementXXYYDistanceDistanceOptionsOptionsCoordinatesCoordinatesAround pointAround pointOver pointOver pointLabel placementLabel placementBar OrientationBar OrientationLegendLegendFormatFormatStart angleStart angleVisibilityVisibilityMaximum valueMaximum valueFindFindScaled sizeScaled sizeDiagram z-indexDiagram z-indexAbove lineAbove lineBelow lineBelow lineOn lineOn lineLine orientation dependent positionLine orientation dependent positionPriorityPriorityLabels are placed in an equal radius circle around point features.Labels are placed in an equal radius circle around point features.Labels are placed at a fixed offset from the point.Labels are placed at a fixed offset from the point.Over LineOver LineAround LineAround LineInside PolygonInside PolygonAround CentroidAround CentroidOver CentroidOver CentroidUsing PerimeterUsing PerimeterUpUpDownDownRightRightLeftLeftShow legend entries for diagram attributesShow legend entries for diagram attributesLegend Entries for Diagram Size...Legend Entries for Diagram Size...AttributesAttributesAutomated placement settings (apply to all layers)Automated placement settings (apply to all layers)RenderingRenderingAvailable attributesAvailable attributesAdd expressionAdd expressionAdd selected attributesAdd selected attributesRemove selected attributesRemove selected attributesAssigned attributesAssigned attributesDrag and drop to reorderDrag and drop to reorderColorColorQgsDirectoryItemNew Directory…New Directory…Create DirectoryCreate DirectoryDirectory nameDirectory nameThe path “%1” already exists.The path “%1” already exists.Could not create directory “%1”.Could not create directory “%1”.Open Directory…Open Directory…QgsDirectoryParamWidgetNameNameSizeSizeDateDatePermissionsPermissionsOwnerOwnerGroupGroupTypeTypefolderfolderfilefileQgsDiscoverRelationsDlgBaseDiscover RelationsDiscover RelationsNameNameReferencing LayerReferencing LayerReferencing FieldReferencing FieldReferenced LayerReferenced LayerReferenced FieldReferenced FieldStrengthStrengthQgsDisplayAngleBaseAngleAngleQgsDockWidgetPluginA dock widgetA dock widgetQgsDualViewSort by preview expressionSort by preview expressionExpression Based PreviewExpression Based PreviewColumn PreviewColumn PreviewCould not set column '%1' as preview column.
Parser error:
%2Could not set column '%1' as preview column.
Parser error:
%2&Sort…&Sort…&Autosize&AutosizeCopy Cell ContentCopy Cell ContentZoom to FeatureZoom to FeaturePan to FeaturePan to FeatureFlash FeatureFlash FeatureRun Layer ActionRun Layer ActionOpen FormOpen Form&Hide Column&Hide Column&Set Width…&Set Width…&Organize Columns…&Organize Columns…Set column widthSet column widthEnter column widthEnter column widthConfigure Attribute Table Sort OrderConfigure Attribute Table Sort OrderLoading features…Loading features…Attribute TableAttribute TableDefined sort order in attribute tableDefined sort order in attribute tableSort ascendingSort ascendingAbortAbort%1 features loaded.%1 features loaded.QgsDualViewBase……ExpressionExpressionColumn PreviewColumn PreviewQgsDummyConfigDlgBaseFormFormDummy TextDummy TextQgsDwgImportBaseDWG/DXF ImportDWG/DXF ImportLayerLayerVisibleVisibleGroup nameGroup nameMerge layersMerge layersImportImportSource drawingSource drawingTarget packageTarget packageSelect GeoPackage DatabaseSelect GeoPackage DatabaseReloadReloadLayers to Import into ProjectLayers to Import into ProjectDeselect AllDeselect AllSelect AllSelect AllImport Drawing into GeoPackageImport Drawing into GeoPackageCRSCRSLoad layersLoad layersExpand block referencesExpand block referencesUse curvesUse curvesQgsDwgImportDialogSelect the coordinate reference system for the dxf file. The data points will be transformed from the layer coordinate reference system.Select the coordinate reference system for the dxf file. The data points will be transformed from the layer coordinate reference system.Drawing file was meanwhile updated (%1 > %2).Drawing file was meanwhile updated (%1 > %2).Drawing file unavailable.Drawing file unavailable.Could not open layer listCould not open layer listSelect DWG/DXF fileSelect DWG/DXF fileDXF/DWG filesDXF/DWG filesDrawing import completed.Drawing import completed.Drawing import failed (%1)Drawing import failed (%1)QgsDxfExportDialogDXF filesDXF filesSelect the coordinate reference system for the dxf file. The data points will be transformed from the layer coordinate reference system.Select the coordinate reference system for the dxf file. The data points will be transformed from the layer coordinate reference system.Export as DXFExport as DXFQgsDxfExportDialogBaseSymbology modeSymbology modeSymbology scaleSymbology scaleSave asSave asDXF ExportDXF ExportNo symbologyNo symbologyFeature symbologyFeature symbologySymbol layer symbologySymbol layer symbologyCRSCRSSelect AllSelect AllDeselect AllDeselect AllMap themesMap themesExport features intersecting the current map extentExport features intersecting the current map extentForce 2d output (eg. to support polyline width)Force 2d output (eg. to support polyline width)Export labels as MTEXT elementsExport labels as MTEXT elementsEncodingEncodingUse layer title as name if setUse layer title as name if setQgsEditorWidgetRegistryClassificationClassificationRangeRangeUnique ValuesUnique ValuesValue MapValue MapEnumerationEnumerationHiddenHiddenText EditText EditCheckboxCheckboxValue RelationValue RelationUuid GeneratorUuid GeneratorAttachmentAttachmentKey/ValueKey/ValueListListQgsEditorWidgetRegistry: Factory not valid.QgsEditorWidgetRegistry: Factory not valid.QgsEditorWidgetRegistry: Factory with id %1 already registered.QgsEditorWidgetRegistry: Factory with id %1 already registered.ColorColorRelation ReferenceRelation ReferenceDate/TimeDate/TimeQgsEditorWidgetWrapperNot NULLNot NULLUniqueUniqueConstraint checks passedConstraint checks passedQgsEffectDrawModeComboBoxRender onlyRender onlyModifier onlyModifier onlyRender and modifyRender and modifyQgsEffectStackCompactWidgetDraw effectsDraw effectsCustomize effectsCustomize effectsQgsEffectStackPropertiesDialogEffect PropertiesEffect PropertiesQgsEffectStackPropertiesWidgetEffects PropertiesEffects PropertiesQgsEffectStackPropertiesWidgetBaseEffectsEffectsAdd new effectAdd new effectRemove effectRemove effectMove upMove upMove downMove downQgsEllipseSymbolLayerWidgetSelect Fill ColorSelect Fill ColorTransparent FillTransparent FillTransparent StrokeTransparent StrokeSelect Stroke ColorSelect Stroke ColorQgsEmbeddedLayerSelectDialogSelect Layers to EmbedSelect Layers to EmbedQgsEncodingFileDialogEncoding:Encoding:Cancel &AllCancel &AllQgsEncodingSelectionDialogEncodingEncodingSelect EncodingSelect EncodingSystemSystemQgsErrorDialogErrorErrorQgsErrorDialogBaseDialogDialogAlways show detailsAlways show detailsDetails >>Details >><!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.0//EN" "http://www.w3.org/TR/REC-html40/strict.dtd">
<html><head><meta name="qrichtext" content="1" /><style type="text/css">
p, li { white-space: pre-wrap; }
</style></head><body style=" font-family:'Ubuntu'; font-size:11pt; font-weight:400; font-style:normal;">
<p style=" margin-top:0px; margin-bottom:0px; margin-left:0px; margin-right:0px; -qt-block-indent:0; text-indent:0px;"><span style=" font-family:'DejaVu Sans'; font-size:10pt;">Summary</span></p></body></html><!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.0//EN" "http://www.w3.org/TR/REC-html40/strict.dtd">
<html><head><meta name="qrichtext" content="1" /><style type="text/css">
p, li { white-space: pre-wrap; }
</style></head><body style=" font-family:'Ubuntu'; font-size:11pt; font-weight:400; font-style:normal;">
<p style=" margin-top:0px; margin-bottom:0px; margin-left:0px; margin-right:0px; -qt-block-indent:0; text-indent:0px;"><span style=" font-family:'DejaVu Sans'; font-size:10pt;">Summary</span></p></body></html><!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.0//EN" "http://www.w3.org/TR/REC-html40/strict.dtd">
<html><head><meta name="qrichtext" content="1" /><style type="text/css">
p, li { white-space: pre-wrap; }
</style></head><body style=" font-family:'Ubuntu'; font-size:11pt; font-weight:400; font-style:normal;">
<p style=" margin-top:0px; margin-bottom:0px; margin-left:0px; margin-right:0px; -qt-block-indent:0; text-indent:0px;"><span style=" font-family:'DejaVu Sans'; font-size:10pt;">Detailed report.</span></p></body></html><!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.0//EN" "http://www.w3.org/TR/REC-html40/strict.dtd">
<html><head><meta name="qrichtext" content="1" /><style type="text/css">
p, li { white-space: pre-wrap; }
</style></head><body style=" font-family:'Ubuntu'; font-size:11pt; font-weight:400; font-style:normal;">
<p style=" margin-top:0px; margin-bottom:0px; margin-left:0px; margin-right:0px; -qt-block-indent:0; text-indent:0px;"><span style=" font-family:'DejaVu Sans'; font-size:10pt;">Detailed report.</span></p></body></html>QgsExpressionNo root node! Parsing failed?No root node! Parsing failed?function help for %1 missingfunction help for %1 missinggroupgroup%1 %2%1 %2SyntaxSyntaxoperatoroperatorfunctionfunctionArgumentsArgumentsExamplesExamplesNotesNotesempty geometryempty geometrygeometry: %1geometry: %1map layermap layerfeature: %1feature: %1interval: %1 daysinterval: %1 daysgradient rampgradient rampdate: %1date: %1time: %1time: %1datetime: %1datetime: %1GeneralGeneralOperatorsOperatorsConditionalsConditionalsFields and ValuesFields and ValuesMathMathConversionsConversionsDate and TimeDate and TimeStringStringColorColorGeometryGeometryRecordRecordVariablesVariablesFuzzy MatchingFuzzy Matching[ ] marks optional components[ ] marks optional componentsRecent (%1)Recent (%1)<i>NULL</i><i>NULL</i>'%1…''%1…'%1…%1…expressionexpressionIf represent_value is called with 1 parameter, it must be an attribute.If represent_value is called with 1 parameter, it must be an attribute.represent_value must be called with exactly 1 or 2 parameters.represent_value must be called with exactly 1 or 2 parameters.QgsExpressionBuilderDialogBaseExpression String BuilderExpression String BuilderQgsExpressionBuilderWidgetSearch…Search…"""Define a new function using the @qgsfunction decorator.
The function accepts the following parameters
: param [any]: Define any parameters you want to pass to your function before
the following arguments.
: param feature: The current feature
: param parent: The QgsExpression object
: param context: If there is an argument called ``context`` found at the last
position, this variable will contain a ``QgsExpressionContext``
object, that gives access to various additional information like
expression variables. E.g. ``context.variable( 'layer_id' )``
: returns: The result of the expression.
The @qgsfunction decorator accepts the following arguments:
: param args: Defines the number of arguments. With ``args = 'auto'`` the number of
arguments will automatically be extracted from the signature.
With ``args = -1``, any number of arguments are accepted.
: param group: The name of the group under which this expression function will
be listed.
: param handlesnull: Set this to True if your function has custom handling for NULL values.
If False, the result will always be NULL as soon as any parameter is NULL.
Defaults to False.
: param usesgeometry : Set this to False if your function does not access
feature.geometry(). Defaults to True.
: param referenced_columns: An array of attribute names that are required to run
this function. Defaults to [QgsFeatureRequest.ALL_ATTRIBUTES].
""""""Define a new function using the @qgsfunction decorator.
The function accepts the following parameters
: param [any]: Define any parameters you want to pass to your function before
the following arguments.
: param feature: The current feature
: param parent: The QgsExpression object
: param context: If there is an argument called ``context`` found at the last
position, this variable will contain a ``QgsExpressionContext``
object, that gives access to various additional information like
expression variables. E.g. ``context.variable( 'layer_id' )``
: returns: The result of the expression.
The @qgsfunction decorator accepts the following arguments:
: param args: Defines the number of arguments. With ``args = 'auto'`` the number of
arguments will automatically be extracted from the signature.
With ``args = -1``, any number of arguments are accepted.
: param group: The name of the group under which this expression function will
be listed.
: param handlesnull: Set this to True if your function has custom handling for NULL values.
If False, the result will always be NULL as soon as any parameter is NULL.
Defaults to False.
: param usesgeometry : Set this to False if your function does not access
feature.geometry(). Defaults to True.
: param referenced_columns: An array of attribute names that are required to run
this function. Defaults to [QgsFeatureRequest.ALL_ATTRIBUTES].
"""Enter new file nameEnter new file nameFile name:File name:Recent (%1)Recent (%1)Map LayersMap LayersRelationsRelationsParser ErrorsParser ErrorsEval ErrorEval ErrorExpression is invalid <a href=more>(more info)</a>Expression is invalid <a href=more>(more info)</a>Inserts the relation ID for the relation named '%1'.Inserts the relation ID for the relation named '%1'.Current value: '%1'Current value: '%1'Inserts the layer ID for the layer named '%1'.Inserts the layer ID for the layer named '%1'.More Info on Expression ErrorMore Info on Expression ErrorLoad First 10 Unique ValuesLoad First 10 Unique ValuesLoad All Unique ValuesLoad All Unique ValuesSaving…Saving…QgsExpressionBuilderWidgetBaseFormFormEqual operatorEqual operator==Addition operatorAddition operator++Subtraction operatorSubtraction operator--Division operatorDivision operator//Multiplication operatorMultiplication operator**Power operatorPower operator^^String ConcatenationString Concatenation||||Open Bracket Open Bracket ((Close Bracket Close Bracket ))'\n''\n'Run the current editor text in QGIS (also saves current script).
Use this when testing your functions.
Saved scripts are auto loaded on QGIS startup.Run the current editor text in QGIS (also saves current script).
Use this when testing your functions.
Saved scripts are auto loaded on QGIS startup.Save and Load FunctionsSave and Load FunctionsHelpHelpOutput preview is generated <br> using the first feature from the layer.Output preview is generated <br> using the first feature from the layer.Output preview: Output preview: ExpressionExpressionNew LineNew LineExpected Format:Expected Format:string [r,g,b,a] as int 0-255 or #RRGGBBAA as hex or color as color's namestring [r,g,b,a] as int 0-255 or #RRGGBBAA as hex or color as color's nameValuesValuesAll UniqueAll Unique10 Samples10 SamplesFunction EditorFunction EditorCreate a new function file based on the template file.
Change the name of the script and save to allow QGIS to auto load on startup.Create a new function file based on the template file.
Change the name of the script and save to allow QGIS to auto load on startup.QgsExpressionBuilderWidgetPluginEdit expressionEdit expressionQgsExpressionCalculatorLocatorFilterCopy “%1” to clipboardCopy “%1” to clipboardCalculatorCalculatorQgsExpressionLineEditExpression DialogExpression DialogQgsExpressionNodeBinaryOperatorCan't perform /, *, or % on DateTime and IntervalCan't perform /, *, or % on DateTime and IntervalQgsExpressionNodeColumnRefColumn '%1' not foundColumn '%1' not foundQgsExpressionNodeLiteral[unsupported type: %1; value: %2][unsupported type: %1; value: %2]QgsExpressionNodeUnaryOperatorUnary minus only for numeric values.Unary minus only for numeric values.QgsExpressionSelectionDialogZoomed to %n matching feature(s)number of matching featuresZoomed to %n matching feature(s)Zoomed to %n matching feature(s)No matching features foundNo matching features foundQgsExpressionSelectionDialogBaseSelect by ExpressionSelect by Expression&Close&CloseZoom to FeaturesZoom to Features……Select featuresSelect featuresAdd to current selectionAdd to current selectionRemove from current selectionRemove from current selectionFilter current selectionFilter current selectionQgsExtentGroupBoxExtentExtentlayerlayermap viewmap viewuser defineduser defineddrawn on canvasdrawn on canvasnonenone%1 (current: %2)%1 (current: %2)QgsExtentGroupBoxPluginA group box to enter a map extentA group box to enter a map extentQgsExtentGroupBoxWidgetFormFormWestWestEastEastMap Canvas ExtentMap Canvas ExtentCalculate from LayerCalculate from LayerDraw on CanvasDraw on CanvasCurrent Layer ExtentCurrent Layer ExtentNorthNorthSouthSouthQgsExternalResourceConfigDlgFormFormPathPathDefault pathDefault path<html><head/><body><p>When not empty, always open the file selector at the root of this path for searching new files. If empty, the last used path of this editor widget will be used. If this editor widget has never been used by the user, the project path will be used.</p></body></html><html><head/><body><p>When not empty, always open the file selector at the root of this path for searching new files. If empty, the last used path of this editor widget will be used. If this editor widget has never been used by the user, the project path will be used.</p></body></html><html><head/><body><p>If you want to make the attribute to store only relative paths, toggle one of these options.</p></body></html><html><head/><body><p>If you want to make the attribute to store only relative paths, toggle one of these options.</p></body></html>Relative pathsRelative paths<html><head/><body><p>Set exclusive file selection methods.</p></body></html><html><head/><body><p>Set exclusive file selection methods.</p></body></html><html><head/><body><p>If this option is checked, the attribute can only store filenames (this is the default choice).</p></body></html><html><head/><body><p>If this option is checked, the attribute can only store filenames (this is the default choice).</p></body></html><html><head/><body><p>If this option is checked, the attribute can only store directories and not filenames. The file selector will let you choose only directories and not files.</p></body></html><html><head/><body><p>If this option is checked, the attribute can only store directories and not filenames. The file selector will let you choose only directories and not files.</p></body></html>Relative to project pathRelative to project path……<html><head/><body><p>If possible, this option makes the storage of the filenames with relative paths from the current QGIS project path.</p><p>For example, if your QGIS project is in <span style=" font-style:italic;">"/home/user/my_project.qgs"</span> and your filename is <span style=" font-style:italic;">"/home/user/data/files/test.pdf"</span>, the attribute will only store <span style=" font-style:italic;">"data/files/test.pdf"</span>.</p></body></html><html><head/><body><p>If possible, this option makes the storage of the filenames with relative paths from the current QGIS project path.</p><p>For example, if your QGIS project is in <span style=" font-style:italic;">"/home/user/my_project.qgs"</span> and your filename is <span style=" font-style:italic;">"/home/user/data/files/test.pdf"</span>, the attribute will only store <span style=" font-style:italic;">"data/files/test.pdf"</span>.</p></body></html><html><head/><body><p>If possible, this option makes the storage of the filenames with relative paths from the default path set just above.</p><p>For example, if your default path is <span style=" font-style:italic;">"/home/user/data/"</span> and your filename is <span style=" font-style:italic;">"/home/user/data/files/test.pdf"</span>, the attribute will only store <span style=" font-style:italic;">"files/test.pdf"</span>.</p></body></html><html><head/><body><p>If possible, this option makes the storage of the filenames with relative paths from the default path set just above.</p><p>For example, if your default path is <span style=" font-style:italic;">"/home/user/data/"</span> and your filename is <span style=" font-style:italic;">"/home/user/data/files/test.pdf"</span>, the attribute will only store <span style=" font-style:italic;">"files/test.pdf"</span>.</p></body></html>Relative to default pathRelative to default pathStorage ModeStorage ModeFile pathsFile pathsDirectory pathsDirectory paths<html><head/><body><p>This option displays file paths as clickable hyperlinks. When you click on the file path, the file should normally be opened by the default viewer defined in your operating system.</p></body></html><html><head/><body><p>This option displays file paths as clickable hyperlinks. When you click on the file path, the file should normally be opened by the default viewer defined in your operating system.</p></body></html>Use a hyperlink for document path (read-only)Use a hyperlink for document path (read-only)<html><head/><body><p>By default, the hyperlink is only displayed with the name of the file and not the full path. If you check this option, hyperlinks will be displayed with the complete path.</p></body></html><html><head/><body><p>By default, the hyperlink is only displayed with the name of the file and not the full path. If you check this option, hyperlinks will be displayed with the complete path.</p></body></html>Display the full pathDisplay the full pathDisplay button to open file dialogDisplay button to open file dialogFilterFilter<html><head/><body><p>Filter syntax is borrowed from Qt <a href="http://doc.qt.io/qt-4.8/qfiledialog.html#getOpenFileName"><span style=" text-decoration: underline; color:#0000ff;">QFileDialog::getOpenFileName</span></a><span style=" font-family:'Courier New,courier';">.</span></p><p>If you want simple filter on all pdf files, just use:</p><p><span style=" font-family:'Courier New,courier';">*.pdf</span></p><p>If you want one filter for multiple file extensions (on .pdf, .odt and .doc files):</p><p><span style=" font-family:'Courier New,courier';">*.pdf *.odt *.doc</span></p><p>If you want to describe your filter, use parentheses:</p><p><span style=" font-family:'Courier New,courier';">Text documents (*.pdf, *.odt, *.doc)</span></p><p>If you want multiple filters, separate them with ';;':</p><p><span style=" font-family:'Courier New,courier';">"Images (*.png *.xpm *.jpg);;Text files (*.txt);;XML files (*.xml)"</span></p></body></html><html><head/><body><p>Filter syntax is borrowed from Qt <a href="http://doc.qt.io/qt-4.8/qfiledialog.html#getOpenFileName"><span style=" text-decoration: underline; color:#0000ff;">QFileDialog::getOpenFileName</span></a><span style=" font-family:'Courier New,courier';">.</span></p><p>If you want simple filter on all pdf files, just use:</p><p><span style=" font-family:'Courier New,courier';">*.pdf</span></p><p>If you want one filter for multiple file extensions (on .pdf, .odt and .doc files):</p><p><span style=" font-family:'Courier New,courier';">*.pdf *.odt *.doc</span></p><p>If you want to describe your filter, use parentheses:</p><p><span style=" font-family:'Courier New,courier';">Text documents (*.pdf, *.odt, *.doc)</span></p><p>If you want multiple filters, separate them with ';;':</p><p><span style=" font-family:'Courier New,courier';">"Images (*.png *.xpm *.jpg);;Text files (*.txt);;XML files (*.xml)"</span></p></body></html>HeightHeightAutoAutoDisplay Resource PathDisplay Resource PathIntegrated Document ViewerIntegrated Document Viewer px pxWidthWidthSpecify the size of the preview. If you leave it set to Auto, an optimal size will be calculated.Specify the size of the preview. If you leave it set to Auto, an optimal size will be calculated.TypeTypeNo contentNo contentImageImageWeb viewWeb viewSelect a directorySelect a directoryQgsFeatureActionRun ActionsRun ActionsQgsFeatureListComboBoxJust start typing what you are looking for.Just start typing what you are looking for.QgsFeatureSelectionDlgDialogDialogQgsFieldCalculatorNot available for layerNot available for layerOnly update %1 selected featuresOnly update %1 selected featuresCould not add the new field to the provider.Could not add the new field to the provider.Evaluation ErrorEvaluation ErrorCreate New FieldCreate New FieldCalculating fieldCalculating fieldAn error occurred while evaluating the calculation string:
%1An error occurred while evaluating the calculation string:
%1<geometry><geometry>Please enter a field namePlease enter a field name
The expression is invalid see (more info) for details
The expression is invalid see (more info) for detailsQgsFieldCalculatorBaseOnly update selected featuresOnly update selected featuresThis layer does not support adding new provider fields. You can only add virtual fields.This layer does not support adding new provider fields. You can only add virtual fields.Create a new fieldCreate a new fieldOutput field nameOutput field nameOutput field lengthOutput field lengthLength of complete output. For example 123,456 means 6 as field length.Length of complete output. For example 123,456 means 6 as field length.Output field typeOutput field type<p>A virtual field will be recalculated every time it is used. Its definition will be saved in the project file. It will not be saved in the dataprovider and therefore its values not be available in other software.</p><p>A virtual field will be recalculated every time it is used. Its definition will be saved in the project file. It will not be saved in the dataprovider and therefore its values not be available in other software.</p>Create virtual fieldCreate virtual fieldPrecisionPrecisionField CalculatorField CalculatorYou are editing information on this layer but the layer is currently not in edit mode. If you click OK, edit mode will automatically be turned on.You are editing information on this layer but the layer is currently not in edit mode. If you click OK, edit mode will automatically be turned on.Update existing fieldUpdate existing fieldQgsFieldComboBoxPluginA combo box to list the fields of a layerA combo box to list the fields of a layerA combo box to list the fields of a layer.A combo box to list the fields of a layer.QgsFieldConditionalFormatWidgetConditional Style Rule ExpressionConditional Style Rule ExpressionQgsFieldConditionalWidgetFormFormFieldFieldNew RuleNew RuleConditionCondition@value@valueConditional Format RulesConditional Format RulesBackgroundBackgroundTextTextIconIconBold text
(data defined only, overrides Style)Bold text
(data defined only, overrides Style)BBItalic text
(data defined only, overrides Style)Italic text
(data defined only, overrides Style)IIUnderlined textUnderlined textUUStrikeout textStrikeout textSSNameNamePresetPresetDoneDoneFull rowFull row……CancelCancelDeleteDeleteQgsFieldExpressionWidgetExpression DialogExpression DialogQgsFieldExpressionWidgetPluginAn editable combo box to enter an expressionAn editable combo box to enter an expressionAn editable combo box to enter an expression. A button allows opening the expression dialog. Expression are evaluated to detect errors.An editable combo box to enter an expression. A button allows opening the expression dialog. Expression are evaluated to detect errors.QgsFileDownloaderNetwork request %1 timed outNetwork request %1 timed outNo output filename specifiedNo output filename specifiedCannot open output file: %1Cannot open output file: %1Download failed: %1Download failed: %1. {1?}QgsFileDownloaderAlgorithmDownload fileDownload filefile,downloader,internet,url,fetch,get,httpsfile,downloader,internet,url,fetch,get,httpsFile toolsFile toolsThis algorithm downloads a URL on the file system.This algorithm downloads a URL on the file system.URLURLFile destinationFile destinationNo URL specifiedNo URL specifiedOutput file doesn't exist.Output file doesn't exist.%1 downloaded.%1 downloaded.%1 of %2 downloaded.%1 of %2 downloaded.QgsFileDownloaderDialogDownloadDownloadDownloading %1.Downloading %1.Download FileDownload FileDownloading %1 of %2 %3.Downloading %1 of %2 %3.QgsFileWidgetSelected files:<br><ul><li>%1</li></ul><br>Selected files:<br><ul><li>%1</li></ul><br>Select a fileSelect a fileSelect one or more filesSelect one or more filesSelect a directorySelect a directoryCreate or select a fileCreate or select a fileQgsFilterAlgorithmConfigurationWidgetOutput NameOutput NameFilter ExpressionFilter ExpressionFinal OutputFinal OutputOutputs and filtersOutputs and filtersAdd OutputAdd OutputRemove Selected OutputsRemove Selected OutputsQgsFirstRunDialogWelcome to QGISWelcome to QGISLet's get started!Let's get started!Welcome to QGIS 3Welcome to QGIS 3<html><head/><body><p><a href="http://changelog.qgis.org/en/qgis/version/3.4-LTR/"><span style=" text-decoration: underline; color:#2a76c6;">Check out </span></a>the change log for all the new stuff.</p></body></html><html><head/><body><p><a href="http://changelog.qgis.org/en/qgis/version/3.4-LTR/"><span style=" text-decoration: underline; color:#2a76c6;">Check out </span></a>the change log for all the new stuff.</p></body></html><html><head/><body><p><span style=" font-style:italic;">You are running a dev version. We would love your feedback and testing.</span></p></body></html><html><head/><body><p><span style=" font-style:italic;">You are running a dev version. We would love your feedback and testing.</span></p></body></html>Ready to go?Ready to go?Import settings from QGIS 2.Import settings from QGIS 2.I want a clean start. Don't import my QGIS 2 settings.I want a clean start. Don't import my QGIS 2 settings.Settings will be imported into the default profile and you will only see this screen once.Settings will be imported into the default profile and you will only see this screen once.Welcome to QGIS %1Welcome to QGIS %1QgsFontButtonText FormatText FormatFontFontAaAaFont size (%1)Font size (%1)Font size (pt)Font size (pt)Recent FontsRecent FontsConfigure Format…Configure Format…Copy FormatCopy FormatPaste FormatPaste FormatCopy ColorCopy ColorPaste ColorPaste ColorQgsFontButtonPluginSelect fontSelect fontQgsFontMarkerSymbolLayerWidgetSelect Symbol Fill ColorSelect Symbol Fill ColorSelect Symbol Stroke ColorSelect Symbol Stroke ColorQgsFormAnnotationDialogDeleteDeleteQt designer fileQt designer fileQgsFormAnnotationDialogBaseForm AnnotationForm Annotation……QgsGCPListModelmap unitsmap unitspixelspixelsVisibleVisibleIDIDSource XSource XSource YSource YDest. XDest. XDest. YDest. YdX (%1)dX (%1)dY (%1)dY (%1)Residual (%1)Residual (%1)QgsGCPListWidgetRecenterRecenterRemoveRemoveQgsGPXProviderBad URI - you need to specify the feature type.Bad URI - you need to specify the feature type.GPS eXchange fileGPS eXchange fileDigitized in QGISDigitized in QGISQgsGdalLayerItemCould not delete file.Could not delete file.File deleted successfully.File deleted successfully.QgsGdalProviderDataset DescriptionDataset DescriptionBand %1Band %1X: %1 Y: %2 Bands: %3X: %1 Y: %2 Bands: %3DimensionsDimensionsGDAL Driver DescriptionGDAL Driver DescriptionGDAL Driver MetadataGDAL Driver MetadataCompressionCompressionMore informationMore informationMask band (exposed as alpha band)Mask band (exposed as alpha band)OriginOriginPixel SizePixel SizeBandBandFormat not supportedFormat not supportedCannot read dataCannot read dataCannot get GDAL raster band: %1Cannot get GDAL raster band: %1QgsGdalSourceSelect Additional credential options are required as documented <a href="%1">here</a>. Additional credential options are required as documented <a href="%1">here</a>.Open GDAL Supported Raster Dataset(s)Open GDAL Supported Raster Dataset(s)Add raster layerAdd raster layerNo layers selected.No layers selected.No protocol URI entered.No protocol URI entered.No protocol bucket and/or key entered.No protocol bucket and/or key entered.QgsGdalSourceSelectBaseAdd Raster Layer(s)Add Raster Layer(s)Source typeSource typeF&ileF&ileProtoco&l: HTTP(S), cloud, etc.Protoco&l: HTTP(S), cloud, etc.SourceSourceRaster Dataset(s)Raster Dataset(s)ProtocolProtocolTypeType&URI&URIBucket or containerBucket or containerObject keyObject key......AuthenticationAuthenticationQgsGenericProjectionSelectorBaseCoordinate Reference System SelectorCoordinate Reference System SelectorQgsGeoNodeConnectionItemEdit Connection…Edit Connection…Delete ConnectionDelete ConnectionModify GeoNode connectionModify GeoNode connectionQgsGeoNodeNewConnectionCreate a New GeoNode ConnectionCreate a New GeoNode ConnectionTest connectionTest connection
Connection to %1 was successful,
%1 is a valid GeoNode instance.
Connection to %1 was successful,
%1 is a valid GeoNode instance.
Connection failed,
please check whether %1 is a valid GeoNode instance.
Connection failed,
please check whether %1 is a valid GeoNode instance.
Invalid URLInvalid URLYour URL doesn't contain a protocol (e.g. http or https). Please add the protocol.Your URL doesn't contain a protocol (e.g. http or https). Please add the protocol.QgsGeoNodeRequest%1 of %2 bytes of request downloaded.%1 of %2 bytes of request downloaded.Redirect loop detected: %1Redirect loop detected: %1GeoNodeGeoNodeEmpty capabilities: %1Empty capabilities: %1Request failed: %1Request failed: %1QgsGeoNodeRootItemNew Connection…New Connection…QgsGeoNodeSourceSelectTitleTitleNameNameTypeTypeWeb ServiceWeb ServiceModify GeoNode ConnectionModify GeoNode ConnectionAre you sure you want to remove the %1 connection and all associated settings?Are you sure you want to remove the %1 connection and all associated settings?Delete GeoNode ConnectionDelete GeoNode ConnectionGeoNodeGeoNodeLayerLayerWMSWMSWFSWFSXYZXYZConnect to GeoNodeConnect to GeoNodeCannot get any feature services.Cannot get any feature services.Load ConnectionsLoad ConnectionsXML files (*.xml *.XML)XML files (*.xml *.XML)MapMapQgsGeoPackageAbstractLayerItemDelete Layer '%1'…Delete Layer '%1'…Delete LayerDelete LayerLayer <b>%1</b> deleted successfully.Layer <b>%1</b> deleted successfully.QgsGeoPackageCollectionItemRemove ConnectionRemove ConnectionAdd ConnectionAdd ConnectionCreate a New Layer or Table…Create a New Layer or Table…Compact Database (VACUUM)Compact Database (VACUUM)Could not delete GeoPackage.Could not delete GeoPackage.GeoPackage deleted successfully.GeoPackage deleted successfully.GeoPackage importGeoPackage importYou cannot import layer %1 over itself!You cannot import layer %1 over itself!%1: %2%1: %2Cannot Overwrite LayerCannot Overwrite LayerDestination layer <b>%1</b> already exists. Overwriting with raster layers is not currently supported.Destination layer <b>%1</b> already exists. Overwriting with raster layers is not currently supported.Overwrite LayerOverwrite LayerDestination layer <b>%1</b> already exists. Do you want to overwrite it?Destination layer <b>%1</b> already exists. Do you want to overwrite it?Import to GeoPackage databaseImport to GeoPackage databaseImport was successful.Import was successful.Failed to import some vector layers!
Failed to import some vector layers!
Failed to import some raster layers!
Failed to import some raster layers!
%1: Not a valid layer!%1: Not a valid layer!Failed to import some layers!
Failed to import some layers!
Database compact (VACUUM)Database compact (VACUUM)Vacuuming %1Vacuuming %1There was an error compacting (VACUUM) the database <b>%1</b>: %2There was an error compacting (VACUUM) the database <b>%1</b>: %2Layer path is empty: layer cannot be deleted!Layer path is empty: layer cannot be deleted!There was an error deleting the layer %1: %2There was an error deleting the layer %1: %2Layer URI is empty: layer cannot be deleted!Layer URI is empty: layer cannot be deleted!QgsGeoPackageConnectionItemRemove ConnectionRemove ConnectionCreate a New Layer or Table…Create a New Layer or Table…Compact Database (VACUUM)Compact Database (VACUUM)QgsGeoPackageRasterWriterTaskSaving %1Saving %1QgsGeoPackageRootItemNew Connection…New Connection…Create Database…Create Database…QgsGeomColumnTypeThreadRetrieving tables of %1…Retrieving tables of %1…Scanning column %1.%2.%3…Scanning column %1.%2.%3…Table retrieval finished.Table retrieval finished.Table retrieval stopped.Table retrieval stopped.QgsGeometryAngleCheckResulting geometry is degenerateResulting geometry is degenerateFailed to delete vertexFailed to delete vertexUnknown methodUnknown methodDelete node with small angleDelete node with small angleNo actionNo actionMinimal angleMinimal angleQgsGeometryAreaCheckFailed to merge with neighbor: %1Failed to merge with neighbor: %1Unknown methodUnknown methodMerge with neighboring polygon with longest shared edgeMerge with neighboring polygon with longest shared edgeMerge with neighboring polygon with largest areaMerge with neighboring polygon with largest areaMerge with neighboring polygon with identical attribute value, if any, or leave as isMerge with neighboring polygon with identical attribute value, if any, or leave as isDelete featureDelete featureNo actionNo actionMinimal areaMinimal areaQgsGeometryCheckerDialogCheck GeometriesCheck GeometriesSetupSetupResultResultQgsGeometryCheckerFixDialogFix ErrorsFix ErrorsNextNextFixFixSkipSkipSelect how to fix error "%1":Select how to fix error "%1":<b>Fixed:</b> %1<b>Fixed:</b> %1<span color="red"><b>Fixed failed:</b> %1</span><span color="red"><b>Fixed failed:</b> %1</span><b>Error is obsolete</b><b>Error is obsolete</b>QgsGeometryCheckerFixSummaryDialogSummarySummaryLayerLayerObject IDObject IDErrorErrorCoordinatesCoordinatesValueValueThe following checks reported errors:The following checks reported errors:%1 errors were fixed%1 errors were fixed%1 new errors were found%1 new errors were found%1 errors were not fixed%1 errors were not fixed%1 errors are obsolete%1 errors are obsoleteQgsGeometryCheckerPluginGeometry CheckerGeometry CheckerCheck geometries for errorsCheck geometries for errorsVectorVectorVersion 0.1Version 0.1Check Geometries…Check Geometries…QgsGeometryCheckerResultTabFormForm<b>Geometry check result:</b><b>Geometry check result:</b>Object IDObject IDErrorErrorWhen a row is selected, move canvas toWhen a row is selected, move canvas toLayerLayerCoordinatesCoordinatesValueValueResolutionResolutionAttributeAttributeExportExportTotal errors: 0Total errors: 0FeatureFeatureDon't &moveDon't &moveHighlight contour of selected featuresHighlight contour of selected featuresFix selected errors using default resolutionFix selected errors using default resolutionFix selected errors, prompt for resolution methodFix selected errors, prompt for resolution methodError resolution settingsError resolution settingsShow selected features in attribute tableShow selected features in attribute tableAttribute to use when merging features by attribute value:Attribute to use when merging features by attribute value:The following checks reported errors:The following checks reported errors:Total errors: %1, fixed errors: %2Total errors: %1, fixed errors: %2Fixed: %1Fixed: %1Fix failed: %1Fix failed: %1Select Output FileSelect Output FileRemove LayerRemove LayerCheck Errors OccurredCheck Errors OccurredExport ErrorsExport ErrorsFailed to export errors to %1.Failed to export errors to %1.Do you want to fix %1 errors?Do you want to fix %1 errors?Fix ErrorsFix ErrorsSet Error ResolutionsSet Error ResolutionsSelect default error resolutions:Select default error resolutions:One or more layers have been removed.One or more layers have been removed.QgsGeometryCheckerSetupTabFormFormOnly selected featuresOnly selected featuresSelf intersectionsSelf intersectionsDuplicate nodesDuplicate nodesPolygon with less than 3 nodesPolygon with less than 3 nodesInput vector layersInput vector layersAllowed geometry typesAllowed geometry typesPointPointMultipointMultipointLineLineMultilineMultilinePolygonPolygonMultipolygonMultipolygonGeometry validityGeometry validitySelf contactsSelf contactsGeometry propertiesGeometry propertiesLines must not have danglesLines must not have danglesGeometry conditionsGeometry conditionsMinimum angle between segments (deg)Minimum angle between segments (deg)Minimal segment length (map units)Minimal segment length (map units)Minimal polygon area (map units sqr.)Minimal polygon area (map units sqr.)No sliver polygonsNo sliver polygonsMaximum thinnessMaximum thinnessMax. area (map units sqr.)Max. area (map units sqr.)Topology checksTopology checksPoints must be covered by linesPoints must be covered by linesLines must not intersect with features of layerLines must not intersect with features of layerCheck for overlaps smaller than (map units sqr.)Check for overlaps smaller than (map units sqr.)Points must properly lie inside a polygonPoints must properly lie inside a polygon<i>Note: Topology checks are performed in the current map CRS.</i><i>Note: Topology checks are performed in the current map CRS.</i>Polygons must follow boundaries of layerPolygons must follow boundaries of layerToleranceToleranceOutput vector layersOutput vector layersCreate &new layersCreate &new layers&Modify input layers&Modify input layersFormatFormatOutput directoryOutput directoryFilename prefixFilename prefixPolygons and multipolygons may not contain any holesPolygons and multipolygons may not contain any holesMultipart objects must consist of more that one partMultipart objects must consist of more that one part<html><head/><body><p>Thinness is the ratio between the area of the minimum square containing the polygon and the area of the polygon itself. A square has thinness 1. Default: 20.</p></body></html><html><head/><body><p>Thinness is the ratio between the area of the minimum square containing the polygon and the area of the polygon itself. A square has thinness 1. Default: 20.</p></body></html>Check for duplicatesCheck for duplicatesLines must not intersect any other linesLines must not intersect any other linesCheck for gaps smaller than (map units sqr.)Check for gaps smaller than (map units sqr.)Check for features within other featuresCheck for features within other featuresBrowseBrowseRunRunAbortAbortchecked_checked_Select Output DirectorySelect Output DirectoryCheck GeometriesCheck GeometriesThe selected input layers cannot contain a layer also selected for a topology check.The selected input layers cannot contain a layer also selected for a topology check.The chosen output directory contains one or more input layers.The chosen output directory contains one or more input layers.Input layer '%1' is not allowed to be in editing mode.Input layer '%1' is not allowed to be in editing mode.Failed to create one or more output layers:
%1Failed to create one or more output layers:
%1The following output layers are in a format that does not support editing features:
%1
The geometry check can be performed, but it will not be possible to fix any errors. Do you want to continue?The following output layers are in a format that does not support editing features:
%1
The geometry check can be performed, but it will not be possible to fix any errors. Do you want to continue?<b>Preparing output...</b><b>Preparing output...</b>The specified output format cannot be recognized.The specified output format cannot be recognized.<b>Waiting for running checks to finish...</b><b>Waiting for running checks to finish...</b><b>Building spatial index...</b><b>Building spatial index...</b>QgsGeometryContainedCheckContained check failed for (%1): the geometry is invalidContained check failed for (%1): the geometry is invalidContained check failed for (%1, %2): %3Contained check failed for (%1, %2): %3Unknown methodUnknown methodDelete featureDelete featureNo actionNo actionWithinWithinQgsGeometryContainedCheckErrorWithin featureWithin featureQgsGeometryDangleCheckUnknown methodUnknown methodNo actionNo actionDangleDangleQgsGeometryDegeneratePolygonCheckUnknown methodUnknown methodDelete featureDelete featureNo actionNo actionPolygon with less than three nodesPolygon with less than three nodesQgsGeometryDuplicateCheckDuplicate check failed for (%1): the geometry is invalidDuplicate check failed for (%1): the geometry is invalidDuplicate check failed for (%1, %2): %3Duplicate check failed for (%1, %2): %3Unknown methodUnknown methodNo actionNo actionRemove duplicatesRemove duplicatesDuplicateDuplicateQgsGeometryDuplicateNodesCheckResulting geometry is degenerateResulting geometry is degenerateFailed to delete vertexFailed to delete vertexUnknown methodUnknown methodDelete duplicate nodeDelete duplicate nodeNo actionNo actionDuplicate nodeDuplicate nodeQgsGeometryFollowBoundariesCheckUnknown methodUnknown methodNo actionNo actionPolygon does not follow boundariesPolygon does not follow boundariesQgsGeometryGapCheckGap check: %1Gap check: %1Failed to merge with neighbor: %1Failed to merge with neighbor: %1Unknown methodUnknown methodAdd gap area to neighboring polygon with longest shared edgeAdd gap area to neighboring polygon with longest shared edgeNo actionNo actionGapGapQgsGeometryGeneratorSymbolLayerWidgetPolygon / MultiPolygonPolygon / MultiPolygonLineString / MultiLineStringLineString / MultiLineStringPoint / MultiPointPoint / MultiPointQgsGeometryHoleCheckUnknown methodUnknown methodRemove holeRemove holeNo actionNo actionPolygon with holePolygon with holeQgsGeometryIsValidCheckIs ValidIs ValidQgsGeometryLineIntersectionCheckUnknown methodUnknown methodNo actionNo actionIntersectionIntersectionQgsGeometryLineLayerIntersectionCheckUnknown methodUnknown methodNo actionNo actionIntersectionIntersectionQgsGeometryMissingVertexCheckUnknown methodUnknown methodNo actionNo actionAdd missing vertexAdd missing vertexMissing VertexMissing VertexQgsGeometryMultipartCheckUnknown methodUnknown methodConvert to single part featureConvert to single part featureDelete featureDelete featureNo actionNo actionMultipart object with only one featureMultipart object with only one featureQgsGeometryOverlapCheckOverlap check failed for (%1): the geometry is invalidOverlap check failed for (%1): the geometry is invalidOverlap check between features %1 and %2 %3Overlap check between features %1 and %2 %3Failed to compute intersection between overlapping features: %1Failed to compute intersection between overlapping features: %1Could not find shared edges between intersection and overlapping featuresCould not find shared edges between intersection and overlapping featuresUnknown methodUnknown methodRemove overlapping area from neighboring polygon with shortest shared edgeRemove overlapping area from neighboring polygon with shortest shared edgeNo actionNo actionOverlapOverlapQgsGeometryPointCoveredByLineCheckUnknown methodUnknown methodNo actionNo actionPoint not covered by linePoint not covered by lineQgsGeometryPointInPolygonCheckPoint in polygon check failed for (%1): the geometry is invalidPoint in polygon check failed for (%1): the geometry is invalidUnknown methodUnknown methodNo actionNo actionPoint not in polygonPoint not in polygonQgsGeometrySegmentLengthCheckUnknown methodUnknown methodNo actionNo actionMinimal segment lengthMinimal segment lengthQgsGeometrySelfContactCheckUnknown methodUnknown methodNo actionNo actionSelf contactSelf contactQgsGeometrySelfIntersectionCheckResulting geometry is degenerateResulting geometry is degenerateUnknown methodUnknown methodSplit feature into a multi-object featureSplit feature into a multi-object featureSplit feature into multiple single-object featuresSplit feature into multiple single-object featuresNo actionNo actionSelf intersectionSelf intersectionQgsGeometrySliverPolygonCheckSliver polygonSliver polygonQgsGeometryTypeCheckUnknown geometry typeUnknown geometry typeUnknown methodUnknown methodConvert to corresponding multi or single type if possible, otherwise delete featureConvert to corresponding multi or single type if possible, otherwise delete featureDelete featureDelete featureNo actionNo actionGeometry typeGeometry typeQgsGeometryTypeCheckErrorOverlap with %1 at feature %2Overlap with %1 at feature %2QgsGeometryValidationDockBaseGeometry ValidationGeometry ValidationNextNextPreviousPreviousZoom To FeatureZoom To FeatureZoom To ProblemZoom To ProblemDetailed DescriptionDetailed Description......QgsGeometryValidationModel%1: %2%1: %2%1: %n Errors%1: %n Errors%1: %n ErrorsQgsGeometryValidationServiceRunning geometry validation checks before saving…Running geometry validation checks before saving…Geometry ValidationGeometry ValidationGeometry errors have been found. Please fix the errors before saving the layer.Geometry errors have been found. Please fix the errors before saving the layer.Geometry errors have been found.Geometry errors have been found.QgsGeonodeSourceSelectBaseAdd GeoNode LayerAdd GeoNode LayerGeoNode ConnectionsGeoNode ConnectionsConnect to selected serviceConnect to selected serviceC&onnectC&onnectCreate a new service connectionCreate a new service connection&New&NewEdit selected service connectionEdit selected service connectionEditEditRemove connection to selected serviceRemove connection to selected serviceRemoveRemoveLoad connections from fileLoad connections from fileLoadLoadSave connections to fileSave connections to fileSaveSaveUse title for layer nameUse title for layer nameFilterFilterDisplay WFS FeatureTypes containing this word in the title, name or abstractDisplay WFS FeatureTypes containing this word in the title, name or abstractQgsGeorefConfigDialogA5 (148x210 mm)A5 (148x210 mm)A4 (210x297 mm)A4 (210x297 mm)A3 (297x420 mm)A3 (297x420 mm)A2 (420x594 mm)A2 (420x594 mm)A1 (594x841 mm)A1 (594x841 mm)A0 (841x1189 mm)A0 (841x1189 mm)B5 (176 x 250 mm)B5 (176 x 250 mm)B4 (250 x 353 mm)B4 (250 x 353 mm)B3 (353 x 500 mm)B3 (353 x 500 mm)B2 (500 x 707 mm)B2 (500 x 707 mm)B1 (707 x 1000 mm)B1 (707 x 1000 mm)B0 (1000 x 1414 mm)B0 (1000 x 1414 mm)Legal (8.5x14 inches)Legal (8.5x14 inches)ANSI A (Letter; 8.5x11 inches)ANSI A (Letter; 8.5x11 inches)ANSI B (Tabloid; 11x17 inches)ANSI B (Tabloid; 11x17 inches)ANSI C (17x22 inches)ANSI C (17x22 inches)ANSI D (22x34 inches)ANSI D (22x34 inches)ANSI E (34x44 inches)ANSI E (34x44 inches)Arch A (9x12 inches)Arch A (9x12 inches)Arch B (12x18 inches)Arch B (12x18 inches)Arch C (18x24 inches)Arch C (18x24 inches)Arch D (24x36 inches)Arch D (24x36 inches)Arch E (36x48 inches)Arch E (36x48 inches)Arch E1 (30x42 inches)Arch E1 (30x42 inches)QgsGeorefConfigDialogBaseConfigure GeoreferencerConfigure GeoreferencerPoint tipPoint tipShow IDsShow IDsShow coordinatesShow coordinatesResidual unitsResidual unitsPixelsPixelsUse map units if possibleUse map units if possiblePDF reportPDF reportLeft marginLeft margin mm mmRight marginRight marginShow Georeferencer window dockedShow Georeferencer window dockedPDF mapPDF mapPaper sizePaper sizeQgsGeorefDescriptionDialog<h2>Description</h2><p>This plugin can georeference raster files and set projection. You select points on the raster and give their world coordinates, and the plugin will compute the world file parameters. The more coordinates you can provide the better the result will be.</p><h2>Description</h2><p>This plugin can georeference raster files and set projection. You select points on the raster and give their world coordinates, and the plugin will compute the world file parameters. The more coordinates you can provide the better the result will be.</p>QgsGeorefDescriptionDialogBaseDescription georeferencerDescription georeferencer<!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.0//EN" "http://www.w3.org/TR/REC-html40/strict.dtd">
<html><head><meta name="qrichtext" content="1" /><style type="text/css">
p, li { white-space: pre-wrap; }
</style></head><body style=" font-family:'Droid Sans'; font-size:11pt; font-weight:400; font-style:normal;">
<p style="-qt-paragraph-type:empty; margin-top:12px; margin-bottom:12px; margin-left:0px; margin-right:0px; -qt-block-indent:0; text-indent:0px; font-family:'Sans Serif'; font-size:10pt;"></p></body></html><!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.0//EN" "http://www.w3.org/TR/REC-html40/strict.dtd">
<html><head><meta name="qrichtext" content="1" /><style type="text/css">
p, li { white-space: pre-wrap; }
</style></head><body style=" font-family:'Droid Sans'; font-size:11pt; font-weight:400; font-style:normal;">
<p style="-qt-paragraph-type:empty; margin-top:12px; margin-bottom:12px; margin-left:0px; margin-right:0px; -qt-block-indent:0; text-indent:0px; font-family:'Sans Serif'; font-size:10pt;"></p></body></html>QgsGeorefPlugin&Georeferencer…&Georeferencer…QgsGeorefPluginGuiGeoreferencerGeoreferencerAll other files (*)All other files (*)Raster loaded: %1Raster loaded: %1Georeferencer - %1Georeferencer - %1Georeference SuccessfulGeoreference SuccessfulRaster was successfully georeferenced.Raster was successfully georeferenced.Transform: Transform: Invalid TransformInvalid TransformGDAL scripting is not supported for %1 transformation.GDAL scripting is not supported for %1 transformation.No GCP points are available to save.No GCP points are available to save.Raster PropertiesRaster PropertiesPlease load raster to be georeferenced.Please load raster to be georeferenced.Write ErrorWrite ErrorCould not write to GCP points file %1.Could not write to GCP points file %1.Transform FailedTransform FailedFailed to calculate linear transform parameters.Failed to calculate linear transform parameters.Failed to compute GCP transform: Transform is not solvable.Failed to compute GCP transform: Transform is not solvable.Could not write to %1.Could not write to %1.Copy to ClipboardCopy to ClipboardGDAL ScriptGDAL ScriptNo Raster LoadedNo Raster LoadedNot Enough GCPsNot Enough GCPs%1 transformation requires at least %2 GCPs. Please define more.%1 transformation requires at least %2 GCPs. Please define more.GCP fileGCP fileHelpHelpReset GeoreferencerReset GeoreferencerReset georeferencer and clear all GCP points?Reset georeferencer and clear all GCP points?GCP file successfully loaded.GCP file successfully loaded.PanelsPanelsToolbarsToolbarsCurrent transform parametrisationCurrent transform parametrisationCoordinate: Coordinate: Current map coordinateCurrent map coordinateNoneNoneCoordinate of image(column/line)Coordinate of image(column/line)Save GCPsSave GCPsSave GCP points?Save GCP points?<p>The selected file already seems to have a world file! Do you want to replace it with the new world file?</p><p>The selected file already seems to have a world file! Do you want to replace it with the new world file?</p>Open RasterOpen Raster%1 is not a supported raster data source.%1 is not a supported raster data source.Load GCP PointsLoad GCP PointsInvalid GCP file. File could not be read.Invalid GCP file. File could not be read.Save GCP PointsSave GCP PointsGeoreferenceGeoreferenceSave World FileSave World Filemap unitsmap unitspixelspixelsTransformation parametersTransformation parametersTranslation xTranslation xTranslation yTranslation yScale xScale xScale yScale yRotation [degrees]Rotation [degrees]Mean error [%1]Mean error [%1]ResidualsResidualsIDIDEnabledEnabledPixel XPixel XPixel YPixel YMap XMap XMap YMap YRes X (%1)Res X (%1)Res Y (%1)Res Y (%1)Res Total (%1)Res Total (%1)yesyesnonoTranslation (%1, %2)Translation (%1, %2)Scale (%1, %2)Scale (%1, %2)Rotation: %1Rotation: %1Mean error: %1Mean error: %1%1%1Please set transformation type.Please set transformation type.Please set output raster name.Please set output raster name.LinearLinearHelmertHelmertPolynomial 1Polynomial 1Polynomial 2Polynomial 2Polynomial 3Polynomial 3Thin plate spline (TPS)Thin plate spline (TPS)ProjectiveProjectiveNot setNot setQgsGeorefPluginGuiBaseGeoreferencerGeoreferencerFileFileViewViewEditEditSettingsSettingsGCP tableGCP tableHistogramHistogramOpen Raster...Open Raster...Open rasterOpen rasterCtrl+OCtrl+OZoom InZoom InCtrl++Ctrl++Zoom OutZoom OutCtrl+-Ctrl+-Zoom to LayerZoom to LayerCtrl+Shift+FCtrl+Shift+FPanPanTransformation Settings...Transformation Settings...Transformation settingsTransformation settingsAdd PointAdd PointAdd pointAdd pointCtrl+ACtrl+ADelete PointDelete PointDelete pointDelete pointCtrl+DCtrl+DClose GeoreferencerClose GeoreferencerClose georeferencerClose georeferencerQuitQuitStart GeoreferencingStart GeoreferencingStart georeferencingStart georeferencingCtrl+GCtrl+GGenerate GDAL ScriptGenerate GDAL ScriptGenerate GDAL scriptGenerate GDAL scriptCtrl+CCtrl+CLink Georeferencer to QGISLink Georeferencer to QGISLink QGIS to GeoreferencerLink QGIS to GeoreferencerSave GCP Points as...Save GCP Points as...Save GCP points as...Save GCP points as...Ctrl+SCtrl+SLoad GCP Points...Load GCP Points...Load GCP pointsLoad GCP pointsCtrl+LCtrl+LConfigure Georeferencer...Configure Georeferencer...Raster Properties...Raster Properties...Move GCP PointMove GCP PointLocal Histogram StretchLocal Histogram StretchFull Histogram StretchFull Histogram StretchReset GeoreferencerReset GeoreferencerCtrl+PCtrl+PMove GCP pointMove GCP pointZoom NextZoom NextZoom LastZoom LastQgsGlobeLayerPropertiesFactoryGlobeGlobeQgsGlobePluginDialogCustom…Custom…TMSTMSWMSWMSworld.tifworld.tifRasterRasterTimeoutTimeoutAdd TMS ImageryAdd TMS ImageryTMS URL:TMS URL:Add WMS ImageryAdd WMS ImageryURL:URL:Add Raster ImageryAdd Raster ImageryAdd TMS ElevationAdd TMS ElevationAdd Raster ElevationAdd Raster ElevationQgsGlobePluginDialogGuiBaseGlobe SettingsGlobe SettingsOverride Date / Time (UTC):Override Date / Time (UTC):ElevationElevationMapMapdd.MM.yyyy HH:mmdd.MM.yyyy HH:mmAddAddRemoveRemoveVideoVideoAnti AliasingAnti AliasingSamplesSamples[Leave empty for maximum][Leave empty for maximum]StereoStereoStereo ModeStereo ModeScreen distance (m)Screen distance (m)Screen width (m)Screen width (m)Split stereo horizontal separation (px)Split stereo horizontal separation (px)Split stereo vertical separation (px)Split stereo vertical separation (px)Split stereo vertical eye mappingSplit stereo vertical eye mappingScreen height (m)Screen height (m)Sk&ySk&yAmbient lightingAmbient lightingImageryImageryVertical scale:Vertical scale:<html><head/><body><p><span style=" font-style:italic;">Change requires a restart of the globe plugin</span></p></body></html><html><head/><body><p><span style=" font-style:italic;">Change requires a restart of the globe plugin</span></p></body></html>Eye separation (m)Eye separation (m)Reset to defaultsReset to defaultsAdvancedAdvancedScrollingScrollingSensitivity:Sensitivity:Invert scroll wheelInvert scroll wheelEnable feature identificationEnable feature identificationEnable frustum highlightingEnable frustum highlightingSplit stereo horizontal eye mappingSplit stereo horizontal eye mappingQgsGlobeVectorLayerPropertiesPageFormFormAltitudeAltitudeClampingClampingTerrain following behaviorTerrain following behaviorTerrain following techniqueTerrain following techniqueTechniqueTechniqueGranularity at which to sample the terrainGranularity at which to sample the terrainBindingBindingElevation data resolution at which to sample terrain heightElevation data resolution at which to sample terrain heightResolutionResolutionVertical offset to apply to geometry ZVertical offset to apply to geometry ZOffsetOffsetScale factor to apply to geometry ZScale factor to apply to geometry ZScaleScaleE&xtrusionE&xtrusionHeight [m]Height [m]Extrusion height, either a numeric value, or a field expressionExtrusion height, either a numeric value, or a field expression00Wall gradientWall gradientWall coloring gradientWall coloring gradientWhether the top cap of the extruded geometry should be flatWhether the top cap of the extruded geometry should be flatFlattenFlattenEnable &labelingEnable &labelingDeclutterDeclutterLightingLightingRendering mode:Rendering mode:Rendering method for the layerRendering method for the layerRasterizedRasterizedModel (Simple)Model (Simple)Model (Advanced)Model (Advanced)Rasterize the layer to a texture, and drape it on the terrainRasterize the layer to a texture, and drape it on the terrainRender the layer features as modelsRender the layer features as modelsNoneNoneTerrainTerrainRelativeRelativeAbsoluteAbsoluteDo not clamp Z values to the terrain (but still apply the offset, if applicable)Do not clamp Z values to the terrain (but still apply the offset, if applicable)Sample the terrain under the point, and set the feature's Z to the terrain height, ignoring the feature's original Z valueSample the terrain under the point, and set the feature's Z to the terrain height, ignoring the feature's original Z valueSample the terrain under the point, and add the terrain height to the feature's original Z valueSample the terrain under the point, and add the terrain height to the feature's original Z valueThe feature's Z value describes its height above "height zero", which is typically the ellipsoid or MSLThe feature's Z value describes its height above "height zero", which is typically the ellipsoid or MSLMapMapDrapeDrapeGPUGPUSceneSceneClamp geometry to the map model's elevation dataClamp geometry to the map model's elevation dataClamp geometry to the terrain's scene graphClamp geometry to the terrain's scene graphClamp geometry to the terrain as they are rendered by the GPUClamp geometry to the terrain as they are rendered by the GPUClamp geometry at draw time using projective texturingClamp geometry at draw time using projective texturingVertexVertexCentroidCentroidClamp every vertex independentlyClamp every vertex independentlyClamp to the centroid of the entire geometryClamp to the centroid of the entire geometryQgsGlobeWidgetGlobeGlobeLayersLayersSync extentSync extentReload sceneReload sceneGlobe settingsGlobe settingsCloseCloseQgsGlowWidgetSelect Glow ColorSelect Glow ColorQgsGmlGML Getfeature network request update failed for authcfg %1GML Getfeature network request update failed for authcfg %1GML Getfeature network reply update failed for authcfg %1GML Getfeature network reply update failed for authcfg %1Loading GML data
%1Loading GML data
%1AbortAbortGML Getfeature network request failed with error: %1GML Getfeature network request failed with error: %1NetworkNetworkQgsGmlSchemaCannot guess schemaCannot guess schemaQgsGpsDetectorinternal GPSinternal GPSlocal gpsdlocal gpsd%1: %2%1: %2QgsGpsDeviceDialogNew device %1New device %1Delete DeviceDelete DeviceAre you sure that you want to delete this device?Are you sure that you want to delete this device?QgsGpsDeviceDialogBaseGPS Device EditorGPS Device EditorDevicesDevicesDeleteDeleteNewNewUpdateUpdateDevice nameDevice nameThis is the name of the device as it will appear in the listsThis is the name of the device as it will appear in the listsCommandsCommandsTrack downloadTrack downloadRoute uploadRoute uploadWaypoint downloadWaypoint downloadThe command that is used to download routes from the deviceThe command that is used to download routes from the deviceRoute downloadRoute downloadThe command that is used to upload waypoints to the deviceThe command that is used to upload waypoints to the deviceTrack uploadTrack uploadThe command that is used to download tracks from the deviceThe command that is used to download tracks from the deviceThe command that is used to upload routes to the deviceThe command that is used to upload routes to the deviceThe command that is used to download waypoints from the deviceThe command that is used to download waypoints from the deviceThe command that is used to upload tracks to the deviceThe command that is used to upload tracks to the deviceWaypoint uploadWaypoint upload<!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.0//EN" "http://www.w3.org/TR/REC-html40/strict.dtd">
<html><head><meta name="qrichtext" content="1" /><style type="text/css">
p, li { white-space: pre-wrap; }
</style></head><body style=" font-family:'MS Shell Dlg 2'; font-size:8.25pt; font-weight:400; font-style:normal;">
<p style=" margin-top:12px; margin-bottom:12px; margin-left:0px; margin-right:0px; -qt-block-indent:0; text-indent:0px;"><span style=" font-family:'Sans Serif'; font-size:9pt;">In the download and upload commands there can be special words that will be replaced by QGIS when the commands are used. These words are:</span><span style=" font-family:'Sans Serif'; font-size:9pt; font-style:italic;">%babel</span><span style=" font-family:'Sans Serif'; font-size:9pt;"> - the path to GPSBabel<br /></span><span style=" font-family:'Sans Serif'; font-size:9pt; font-style:italic;">%in</span><span style=" font-family:'Sans Serif'; font-size:9pt;"> - the GPX filename when uploading or the port when downloading<br /></span><span style=" font-family:'Sans Serif'; font-size:9pt; font-style:italic;">%out</span><span style=" font-family:'Sans Serif'; font-size:9pt;"> - the port when uploading or the GPX filename when downloading</span></p></body></html><!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.0//EN" "http://www.w3.org/TR/REC-html40/strict.dtd">
<html><head><meta name="qrichtext" content="1" /><style type="text/css">
p, li { white-space: pre-wrap; }
</style></head><body style=" font-family:'MS Shell Dlg 2'; font-size:8.25pt; font-weight:400; font-style:normal;">
<p style=" margin-top:12px; margin-bottom:12px; margin-left:0px; margin-right:0px; -qt-block-indent:0; text-indent:0px;"><span style=" font-family:'Sans Serif'; font-size:9pt;">In the download and upload commands there can be special words that will be replaced by QGIS when the commands are used. These words are:</span><span style=" font-family:'Sans Serif'; font-size:9pt; font-style:italic;">%babel</span><span style=" font-family:'Sans Serif'; font-size:9pt;"> - the path to GPSBabel<br /></span><span style=" font-family:'Sans Serif'; font-size:9pt; font-style:italic;">%in</span><span style=" font-family:'Sans Serif'; font-size:9pt;"> - the GPX filename when uploading or the port when downloading<br /></span><span style=" font-family:'Sans Serif'; font-size:9pt; font-style:italic;">%out</span><span style=" font-family:'Sans Serif'; font-size:9pt;"> - the port when uploading or the GPX filename when downloading</span></p></body></html>QgsGpsInformationWidget/gps/gpsNo path to the GPS port is specified. Please enter a path then try again.No path to the GPS port is specified. Please enter a path then try again.Timed out!Timed out!Failed to connect to GPS device.Failed to connect to GPS device.Connected!Connected!Dis&connectDis&connectConnected to GPS device.Connected to GPS device.Error opening log file.Error opening log file.Connecting…Connecting…Track ColorTrack ColorConnecting to GPS device %1…Connecting to GPS device %1…Disconnected…Disconnected…&Connect&ConnectDisconnected from GPS device.Disconnected from GPS device.%1 m%1 m%1 km/h%1 km/hNot availableNot availableAutomaticAutomaticManualManual3D3D2D2DNo fixNo fixDifferentialDifferentialNon-differentialNon-differentialNo positionNo positionValidValidInvalidInvalidAdd FeatureAdd FeatureSave Layer EditsSave Layer EditsThe feature could not be added because removing the polygon intersections would change the geometry type.The feature could not be added because removing the polygon intersections would change the geometry type.An error was reported during intersection removal.An error was reported during intersection removal.Cannot close a line feature until it has at least two vertices.Cannot close a line feature until it has at least two vertices.Cannot close a polygon feature until it has at least three vertices.Cannot close a polygon feature until it has at least three vertices.Feature addedFeature addedCould not commit changes to layer %1
Errors: %2
Could not commit changes to layer %1
Errors: %2
Cannot add feature. Unknown WKB type. Choose a different layer and try again.Cannot add feature. Unknown WKB type. Choose a different layer and try again.NMEA filesNMEA filesSave GPS log file AsSave GPS log file As&Add feature&Add feature&Add Point&Add Point&Add Line&Add Line&Add Polygon&Add PolygonQgsGpsInformationWidgetBaseGPS ConnectGPS Connect&Add feature&Add featureQuick status indicator:
green = good or 3D fix
yellow = good 2D fix
red = no fix or bad fix
gray = no data
2D/3D depends on this information being availableQuick status indicator:
green = good or 3D fix
yellow = good 2D fix
red = no fix or bad fix
gray = no data
2D/3D depends on this information being availableAdd track pointAdd track pointReset trackReset track……0000000000Log fileLog fileMap CenteringMap CenteringWhen leavingWhen leavingNeverNeverAlwaysAlwaysLine widthLine width px pxLine colorLine colorFilteringFilteringDistance threshold (meters)Distance threshold (meters)Acquisition interval (seconds)Acquisition interval (seconds)PositionPositionSignalSignalSatelliteSatelliteOptionsOptionsDebugDebug&Connect&Connectlatitude of position fix (degrees)latitude of position fix (degrees)LongitudeLongitudelongitude of position fix (degrees)longitude of position fix (degrees)antenna altitude with respect to geoid (mean sea level)antenna altitude with respect to geoid (mean sea level)AltitudeAltitudeLatitudeLatitudeTime of fixTime of fixdate/time of position fix (UTC)date/time of position fix (UTC)speed over groundspeed over groundSpeedSpeedtrack direction (degrees)track direction (degrees)DirectionDirectionHorizontal Dilution of PrecisionHorizontal Dilution of PrecisionHDOPHDOPVertical Dilution of PrecisionVertical Dilution of PrecisionVDOPVDOPPosition Dilution of PrecisionPosition Dilution of PrecisionPDOPPDOPGPS receiver configuration 2D/3D mode: Automatic or ManualGPS receiver configuration 2D/3D mode: Automatic or ManualModeModeposition fix dimensions: 2D, 3D or No fixposition fix dimensions: 2D, 3D or No fixDimensionsDimensionsquality of the position fix: Differential, Non-differential or No positionquality of the position fix: Differential, Non-differential or No positionQualityQualityposition fix status: Valid or Invalidposition fix status: Valid or InvalidStatusStatusnumber of satellites used in the position fixnumber of satellites used in the position fixSatellitesSatellitesH accuracyH accuracyV accuracyV accuracyConnectionConnectionAutodetectAutodetectSerial deviceSerial deviceRefresh serial device listRefresh serial device listPortPortHostHostDeviceDevicegpsdgpsdInternalInternalDigitizingDigitizingTrackTrackAutomatically add pointsAutomatically add pointsTrack width in pixelsTrack width in pixelssave layer after every feature addedsave layer after every feature addedAutomatically save added featureAutomatically save added featuresave GPS data (NMEA sentences) to a filesave GPS data (NMEA sentences) to a filebrowse for log filebrowse for log file% of map extent% of map extentCursorCursorSmallSmallLargeLargeQgsGpsPlugin&GPS Tools&GPS Tools&Create new GPX layer&Create new GPX layerCreates a new GPX layer and displays it on the map canvasCreates a new GPX layer and displays it on the map canvasImport GPS FileImport GPS FileCould not start GPSBabel.Could not start GPSBabel.Convert GPS FileConvert GPS FileGPS eXchange fileGPS eXchange fileUnable to create a GPX file with the given name. Try again with another name or in another directory.Unable to create a GPX file with the given name. Try again with another name or in another directory.GPX LoaderGPX LoaderUnable to read the selected file.
Please reselect a valid file.Unable to read the selected file.
Please reselect a valid file.Save New GPX File AsSave New GPX File AsSave New GPX FileSave New GPX FileCould not start GPSBabel!Could not start GPSBabel!Download from GPSDownload from GPSDownloading data…Downloading data…Upload to GPSUpload to GPSUploading data…Uploading data…CancelCancelImporting data…Importing data…Could not import data from %1!
Could not import data from %1!
Could not convert data from %1!
Could not convert data from %1!
This device does not support downloading of %1.This device does not support downloading of %1.Could not download data from GPS!
Could not download data from GPS!
This device does not support uploading of %1.This device does not support uploading of %1.Error while uploading data to GPS!
Error while uploading data to GPS!
QgsGpsPluginGuiGPX files (*.gpx)GPX files (*.gpx)WaypointsWaypointsRoutesRoutesTracksTracksChoose a file name to save underChoose a file name to save underGPS eXchange formatGPS eXchange formatSelect GPX fileSelect GPX fileSelect file and format to importSelect file and format to importWaypoints from a routeWaypoints from a routeWaypoints from a trackWaypoints from a trackRoute from waypointsRoute from waypointsTrack from waypointsTrack from waypointsGPS eXchange format (*.gpx)GPS eXchange format (*.gpx)QgsGpsPluginGuiBaseGPS ToolsGPS ToolsLoad GPX fileLoad GPX fileFileFileFeature typesFeature typesWaypointsWaypointsRoutesRoutesTracksTracksImport other fileImport other fileFile to importFile to importBrowse...Browse...Feature typeFeature typeLayer nameLayer nameGPX output fileGPX output fileSave As...Save As...(Note: Selecting correct file type in browser dialog important!)(Note: Selecting correct file type in browser dialog important!)Download from GPSDownload from GPSGPS deviceGPS deviceEdit devices...Edit devices...PortPortRefreshRefreshOutput fileOutput fileUpload to GPSUpload to GPSData layerData layerEdit devicesEdit devicesGPX ConversionsGPX ConversionsGPX input fileGPX input fileConversionConversionQgsGradientColorRampDialogSelect Ramp ColorSelect Ramp ColorTransparentTransparentDiscreteDiscreteContinuousContinuousGradient file : %1Gradient file : %1License file : %1License file : %1QgsGradientColorRampDialogBaseGradient Color RampGradient Color RampColor &1Color &1Color &2Color &2&Type&TypeGradient StopGradient StopRelative &positionRelative &position % %&Delete Stop&Delete StopPlotPlotHueHueSaturationSaturationLightnessLightnessOpacityOpacity&Information&InformationQgsGradientFillSymbolLayerWidgetSelect Gradient ColorSelect Gradient ColorTransparentTransparentQgsGraduatedHistogramWidgetRanges are overlapping and can't be edited by the histogramRanges are overlapping and can't be edited by the histogramRanges have gaps and can't be edited by the histogramRanges have gaps and can't be edited by the histogramQgsGraduatedSymbolRendererModelSymbolSymbolValuesValuesLegendLegendQgsGraduatedSymbolRendererWidgetColumnColumnSymbolSymbolChange...Change...Legend formatLegend formatTemplate for the legend text associated with each classification.
Use "%1" for the lower bound of the classification, and "%2" for the upper bound.Template for the legend text associated with each classification.
Use "%1" for the lower bound of the classification, and "%2" for the upper bound.Precision of upper and lower values in label text.
Positive is number of decimal places
Negative rounds to powers of 10Precision of upper and lower values in label text.
Positive is number of decimal places
Negative rounds to powers of 10Precision Precision Check to remove trailing zeroes after the decimal point from the upper and lower values in the legend.Check to remove trailing zeroes after the decimal point from the upper and lower values in the legend.TrimTrimMethodMethod<html><head/><body><p>Choose between color and size graduation. </p><p><br/></p><p>If you want to combine both, use a data-defined size for the symbol and graduate by color.</p></body></html><html><head/><body><p>Choose between color and size graduation. </p><p><br/></p><p>If you want to combine both, use a data-defined size for the symbol and graduate by color.</p></body></html>Color rampColor rampSize from Size from totoClassesClassesModeModeSymmetric ClassificationSymmetric ClassificationAroundAroundCreate class astride symmetry valueCreate class astride symmetry valueDelete AllDelete AllEqual IntervalEqual IntervalQuantile (Equal Count)Quantile (Equal Count)Natural Breaks (Jenks)Natural Breaks (Jenks)Standard DeviationStandard DeviationPretty BreaksPretty BreaksClassifyClassifyAdd classAdd classDeleteDeleteAdvancedAdvancedLink class boundariesLink class boundariesHistogramHistogramSymbol Levels…Symbol Levels…Data-defined Size Legend…Data-defined Size Legend…Select MethodSelect MethodApply ClassificationApply ClassificationLink Class BoundariesLink Class BoundariesNo color ramp defined.No color ramp defined.Natural break classification (Jenks) is O(n2) complexity, your classification may take a long time.
Press cancel to abort breaks calculation or OK to continue.Natural break classification (Jenks) is O(n2) complexity, your classification may take a long time.
Press cancel to abort breaks calculation or OK to continue.Rows will be reordered before linking boundaries. Continue?Rows will be reordered before linking boundaries. Continue?QgsGrassGRASS was not found in '%1' (GISBASE), provider and plugin will not work.GRASS was not found in '%1' (GISBASE), provider and plugin will not work.GRASS errorGRASS errorCannot add mapset %1 to search path:Cannot add mapset %1 to search path:Cannot close mapset. %1Cannot close mapset. %1Cannot create new mapset directoryCannot create new mapset directoryCannot copy %1 to %2Cannot copy %1 to %2Cannot write regionCannot write regionno mapset openno mapset openCannot query raster
%1Cannot query raster
%1Cannot delete %1 %2: %3Cannot delete %1 %2: %3Cannot start moduleCannot start modulecommand: %1 %2command: %1 %2Problem in GRASS initialization, GRASS provider and plugin will not work : %1Problem in GRASS initialization, GRASS provider and plugin will not work : %1Cannot remove mapset %1 from search path: %2Cannot remove mapset %1 from search path: %2Cannot read raster map region (%1/%2/%3)Cannot read raster map region (%1/%2/%3)Cannot get projectionCannot get projectionCannot get raster extentCannot get raster extentCannot get map infoCannot get map infoCannot get colorsCannot get colorsCannot create new vector: %1Cannot create new vector: %1QgsGrassElementDialogCancelCancelOKOK<font color='red'>Enter a name!</font><font color='red'>Enter a name!</font><font color='red'>This is name of the source!</font><font color='red'>This is name of the source!</font><font color='red'>Exists!</font><font color='red'>Exists!</font>OverwriteOverwriteQgsGrassFeatureIterator<not editable (layer %1)><not editable (layer %1)>QgsGrassImportItemCancelCancelcancelingcancelingQgsGrassImportProgressProgress: %1Progress: %1QgsGrassItemActionsGRASS OptionsGRASS OptionsNew mapsetNew mapsetOpen mapsetOpen mapsetAdd mapset to search pathAdd mapset to search pathRemove mapset from search pathRemove mapset from search pathRenameRenameDeleteDeleteNew Point LayerNew Point LayerNew Line LayerNew Line LayerNew Polygon LayerNew Polygon LayerCannot create new mapset: %1Cannot create new mapset: %1QgsGrassMapcalcMapcalc toolsMapcalc toolsAdd mapAdd mapAdd constant valueAdd constant valueAdd operator or functionAdd operator or functionAdd connectionAdd connectionSelect itemSelect itemDelete selected itemDelete selected itemOpenOpenSaveSaveSave asSave asAdditionAdditionSubtractionSubtractionMultiplicationMultiplicationDivisionDivisionModulusModulusExponentiationExponentiationEqualEqualNot equalNot equalGreater thanGreater thanGreater than or equalGreater than or equalLess thanLess thanLess than or equalLess than or equalAndAndOrOrAbsolute value of xAbsolute value of xInverse tangent of x (result is in degrees)Inverse tangent of x (result is in degrees)Inverse tangent of y/x (result is in degrees)Inverse tangent of y/x (result is in degrees)Current column of moving window (starts with 1)Current column of moving window (starts with 1)Cosine of x (x is in degrees)Cosine of x (x is in degrees)Convert x to double-precision floating pointConvert x to double-precision floating pointCurrent east-west resolutionCurrent east-west resolutionExponential function of xExponential function of xx to the power yx to the power yConvert x to single-precision floating pointConvert x to single-precision floating pointDecision: 1 if x not zero, 0 otherwiseDecision: 1 if x not zero, 0 otherwiseDecision: a if x not zero, 0 otherwiseDecision: a if x not zero, 0 otherwiseDecision: a if x not zero, b otherwiseDecision: a if x not zero, b otherwiseDecision: a if x > 0, b if x is zero, c if x < 0Decision: a if x > 0, b if x is zero, c if x < 0Convert x to integer [ truncates ]Convert x to integer [ truncates ]Check if x = NULLCheck if x = NULLNatural log of xNatural log of xLog of x base bLog of x base bLargest valueLargest valueMedian valueMedian valueSmallest valueSmallest valueMode valueMode value1 if x is zero, 0 otherwise1 if x is zero, 0 otherwiseCurrent north-south resolutionCurrent north-south resolutionNULL valueNULL valueRandom value between a and bRandom value between a and bRound x to nearest integerRound x to nearest integerCurrent row of moving window (Starts with 1)Current row of moving window (Starts with 1)Sine of x (x is in degrees)sin(x)Sine of x (x is in degrees)Square root of xsqrt(x)Square root of xTangent of x (x is in degrees)tan(x)Tangent of x (x is in degrees)Current x-coordinate of moving windowCurrent x-coordinate of moving windowCurrent y-coordinate of moving windowCurrent y-coordinate of moving windowOutputOutputWarningWarningCannot check region of map %1Cannot check region of map %1Cannot get region of map %1Cannot get region of map %1No GRASS raster maps availableNo GRASS raster maps availableCannot create 'mapcalc' directory in current mapset.Cannot create 'mapcalc' directory in current mapset.New mapcalcNew mapcalcEnter new mapcalc name:Enter new mapcalc name:Enter vector nameEnter vector nameThe file already exists. Overwrite?The file already exists. Overwrite?Save mapcalcSave mapcalcFile name emptyFile name emptyCannot open mapcalc fileCannot open mapcalc fileThe mapcalc schema (%1) not found.The mapcalc schema (%1) not found.Cannot open mapcalc schema (%1)Cannot open mapcalc schema (%1)Cannot read mapcalc schema (%1):Cannot read mapcalc schema (%1):
%1
at line %2 column %3
%1
at line %2 column %3QgsGrassMapcalcBaseMain WindowMain WindowOutputOutputEnter constant valueEnter constant valueQgsGrassMapsetItemtopology missingtopology missingtopology version not supportedtopology version not supportedtopology version 6topology version 6emptyempty%1 layer type not supported%1 layer type not supportedCannot create provider %1 : %2Cannot create provider %1 : %2Provider is not valid %1 : %2Provider is not valid %1 : %2Cannot get default location region.Cannot get default location region.Cannot delete %1Cannot delete %1Import to GRASS mapsetImport to GRASS mapsetFailed to import some layers!
Failed to import some layers!
Import to GRASS mapset failedImport to GRASS mapset failedFailed to import %1 to %2: %3Failed to import %1 to %2: %3QgsGrassModuleModule: %1Module: %1WarningWarningThe module file (%1) not found.The module file (%1) not found.Cannot open module file (%1)Cannot open module file (%1)Cannot read module file (%1)Cannot read module file (%1)
%1
at line %2 column %3
%1
at line %2 column %3Module %1 not foundModule %1 not foundCannot find man page %1Cannot find man page %1Please ensure you have the GRASS documentation installed.Please ensure you have the GRASS documentation installed.Not available, description not found (%1)Not available, description not found (%1)Not available, cannot open description (%1)Not available, cannot open description (%1)Not available, incorrect description (%1)Not available, incorrect description (%1)RunRunCannot get input regionCannot get input regionInput %1 outside current region!Input %1 outside current region!Use Input RegionUse Input RegionOutput %1 exists! Overwrite?Output %1 exists! Overwrite?Cannot find module %1Cannot find module %1Cannot start module: %1Cannot start module: %1StopStop<B>Successfully finished</B><B>Successfully finished</B><B>Finished with error</B><B>Finished with error</B><B>Module crashed or killed</B><B>Module crashed or killed</B>QgsGrassModuleBaseGRASS ModuleGRASS ModuleOptionsOptionsOutputOutputManualManualTextLabelTextLabelRunRunView outputView outputCloseCloseQgsGrassModuleFileFileFile%1: missing value%1: missing value%1: directory does not exist%1: directory does not existQgsGrassModuleGdalInputOGR/PostGIS/GDAL InputOGR/PostGIS/GDAL InputCannot find layeroption %1Cannot find layeroption %1Cannot find whereoption %1Cannot find whereoption %1PasswordPasswordSelect a layerSelect a layer%1: no input%1: no inputQgsGrassModuleInputInputInputCannot find typeoption %1Cannot find typeoption %1Cannot find values for typeoption %1Cannot find values for typeoption %1Cannot find layeroption %1Cannot find layeroption %1GRASS element %1 not supportedGRASS element %1 not supportedUse region of this mapUse region of this mapSublayerSublayerno inputno inputcurrent map does not contain features of required typecurrent map does not contain features of required typegeometry type not selectedgeometry type not selectedQgsGrassModuleOptionUnknown outputTypeUnknown outputTypeBrowseBrowseOutput fileOutput fileGeoTIFFGeoTIFFCannot parse version_min %1Cannot parse version_min %1Cannot parse version_max %1Cannot parse version_max %1%1: missing value%1: missing valueQgsGrassModuleSelectionSelected categoriesSelected categoriesManual entryManual entrylayer selectionlayer selectionAdd to canvas layerAdd to canvas layerQgsGrassModuleStandardOptionsCannot get region of map %1Cannot get region of map %1Cannot find module %1Cannot find module %1Cannot start module %1Cannot start module %1commandcommandCannot read module description (%1):Cannot read module description (%1):
%1
at line %2 column %3
%1
at line %2 column %3RegionRegionInput layersInput layersCurrent map canvasCurrent map canvasCannot find key %1Cannot find key %1Option '%1' should be configured as fieldOption '%1' should be configured as fieldThis module has no optionsThis module has no options<< Hide advanced options<< Hide advanced optionsShow advanced options >>Show advanced options >>Item with key %1 not foundItem with key %1 not foundItem with id %1 not foundItem with id %1 not foundQgsGrassModuleVectorFieldAttribute fieldAttribute field'layer' attribute in field tag with key= %1 is missing.'layer' attribute in field tag with key= %1 is missing.QgsGrassNewMapsetDatabaseDatabaseNo writable locations, the database is not writable!No writable locations, the database is not writable!Enter location name!Enter location name!The location exists!The location exists!Selected projection is not supported by GRASS!Selected projection is not supported by GRASS!Cannot create projection.Cannot create projection.Cannot reproject previously set region, default region set.Cannot reproject previously set region, default region set.North must be greater than southNorth must be greater than southEast must be greater than westEast must be greater than westRegions file (%1) not found.Regions file (%1) not found.Cannot open locations file (%1)Cannot open locations file (%1)Cannot read locations file (%1):Cannot read locations file (%1):
%1
at line %2 column %3
%1
at line %2 column %3Cannot create QgsCoordinateReferenceSystemCannot create QgsCoordinateReferenceSystemCannot reproject selected region.Cannot reproject selected region.Cannot reproject regionCannot reproject regionLocationLocationMapsetMapsetCannot create new GRASS database directoryCannot create new GRASS database directoryCannot create new mapset: %1Cannot create new mapset: %1New mapset successfully createdNew mapset successfully createdThe mapset already existsThe mapset already existsCannot create new location: %1Cannot create new location: %1New mapsetNew mapsetNew mapset successfully created, but cannot be opened: %1New mapset successfully created, but cannot be opened: %1New mapset successfully created and set as current working mapset.New mapset successfully created and set as current working mapset.QgsGrassNewMapsetBaseNew MapsetNew MapsetGRASS DatabaseGRASS DatabaseDatabase ErrorDatabase ErrorThe GRASS location is a collection of maps for a particular territory or project.The GRASS location is a collection of maps for a particular territory or project.NorthNorthWestWestEastEastSouthSouthThe GRASS region defines a workspace for raster modules. The default region is valid for one location. It is possible to set a different region in each mapset. It is possible to change the default location region later.The GRASS region defines a workspace for raster modules. The default region is valid for one location. It is possible to set a different region in each mapset. It is possible to change the default location region later.New mapsetNew mapsetExisting mapsetsExisting mapsetsThe GRASS mapset is a collection of maps used by one user. A user can read maps from all mapsets in the location but he can open for writing only his mapset (owned by user).The GRASS mapset is a collection of maps used by one user. A user can read maps from all mapsets in the location but he can open for writing only his mapset (owned by user).DatabaseDatabaseLocationLocationOpen new mapsetOpen new mapsetBrowse...Browse...GRASS LocationGRASS LocationDatabase directoryDatabase directory<html><head/><body><p>GRASS data are stored in tree directory structure. The GRASS database is the top-level directory in this tree structure.</p></body></html><html><head/><body><p>GRASS data are stored in tree directory structure. The GRASS database is the top-level directory in this tree structure.</p></body></html>Select locationSelect locationCreate new locationCreate new locationLocation ErrorLocation ErrorProjectionProjectionProjection ErrorProjection ErrorNot definedNot definedDefault GRASS RegionDefault GRASS RegionSet current QGIS extentSet current QGIS extentSetSetRegion ErrorRegion ErrorMapsetMapsetMapset ErrorMapset ErrorOwnerOwnerCreate New MapsetCreate New MapsetQgsGrassOptionsGRASS versionGRASS versionDefaultDefaultSelect ColorSelect ColorCurrently selected GRASS installation is not validCurrently selected GRASS installation is not validChoose a directory with configuration files (default.qgc, *.qgm)Choose a directory with configuration files (default.qgc, *.qgm)QgsGrassOptionsBaseGRASS OptionsGRASS OptionsModulesModulesBrowserBrowserRegionRegionModules interface configurationModules interface configurationDefaultDefaultGeneralGeneralThe version of GRASS which was used to build the GRASS provider and plugin in QGIS. Exactly the same version must be used on runtime.The version of GRASS which was used to build the GRASS provider and plugin in QGIS. Exactly the same version must be used on runtime.GRASS installationGRASS installationCustomCustomBrowseBrowseGIsbase errorGIsbase errorDebug modeDebug modeImportImportCRS transformationCRS transformationApproximate CRS transformation is fast but it may be inaccurate.Approximate CRS transformation is fast but it may be inaccurate.Create a link to the external data for GDAL data sources with the same CRS as target mapset by r.external, instead of making copy of data.Create a link to the external data for GDAL data sources with the same CRS as target mapset by r.external, instead of making copy of data.Create link to external data if possibleCreate link to external data if possibleLayersLayersShow virtual topological layersShow virtual topological layersRegion borderRegion borderColorColorWidthWidthQgsGrassPluginOpen GRASS toolsOpen GRASS toolsDisplay Current Grass RegionDisplay Current Grass RegionOpen MapsetOpen MapsetNew MapsetNew MapsetClose MapsetClose MapsetOpen GRASS ToolsOpen GRASS ToolsDisplays the current GRASS region as a rectangle on the map canvasDisplays the current GRASS region as a rectangle on the map canvas&GRASS&GRASSGRASSGRASSAdd Closed BoundaryAdd Closed BoundaryGRASS init errorGRASS init errorWarningWarningNew vector nameNew vector nameGRASS OptionsGRASS OptionsAdd PointAdd PointAdd LineAdd LineAdd BoundaryAdd BoundaryAdd CentroidAdd CentroidCannot create new vector: %1Cannot create new vector: %1New vector created but cannot be opened by data provider.New vector created but cannot be opened by data provider.Cannot open the mapset. %1Cannot open the mapset. %1Cannot open GRASS mapset. %1Cannot open GRASS mapset. %1QgsGrassProviderWhole number (integer)Whole number (integer)Decimal number (real)Decimal number (real)TextTextCannot restore record with cat %1Cannot restore record with cat %1Cannot delete orphan record with cat %1Cannot delete orphan record with cat %1GRASS %1 vector providerGRASS %1 vector providerQgsGrassRasterImportData type %1 not supportedData type %1 not supportedWriting band %1/%2Writing band %1/%2Cannot convert block (%1) to data type %2Cannot convert block (%1) to data type %2QgsGrassRasterProvidercellhd file %1 does not existcellhd file %1 does not existGroups not yet supportedGroups not yet supportedCannot read rasterCannot read raster%1 bytes expected but %2 byte were read from qgis.d.rast%1 bytes expected but %2 byte were read from qgis.d.rastFormat not supportedFormat not supportedCannot read dataCannot read dataGRASS raster providerGRASS raster providerQgsGrassRegionBaseExtentExtentNorthNorthWestWestRegionRegionEastEastSelect the extent by dragging on canvasSelect the extent by dragging on canvasSizeSizeN-SN-SE-WE-WSouthSouthResolutionResolutionColumnsColumnsRowsRowsQgsGrassSelectSelect GRASS Vector LayerSelect GRASS Vector LayerSelect GRASS Raster LayerSelect GRASS Raster LayerSelect GRASS Mapcalc SchemaSelect GRASS Mapcalc SchemaSelect GRASS MapsetSelect GRASS MapsetChoose existing GISDBASEChoose existing GISDBASEWrong GISDBASE, no locations available.Wrong GISDBASE, no locations available.Wrong GISDBASEWrong GISDBASESelect a map.Select a map.No mapNo mapNo layerNo layerNo layers available in this mapNo layers available in this mapQgsGrassSelectBaseAdd GRASS LayerAdd GRASS LayerGisdbaseGisdbaseLocationLocationMapsetMapsetMap nameMap nameSelect or type map name (wildcards '*' and '?' accepted for rasters)Select or type map name (wildcards '*' and '?' accepted for rasters)LayerLayerBrowse...Browse...QgsGrassShellCtrl+Shift+VCtrl+Shift+VCtrl+Shift+CCtrl+Shift+CWarningWarningCannot rename the lock file %1Cannot rename the lock file %1QgsGrassToolsGRASS ToolsGRASS ToolsGRASS Tools: %1/%2GRASS Tools: %1/%2Close mapsetClose mapsetRegionRegionCannot start command shell (%1)Cannot start command shell (%1)WarningWarningGRASS Shell is not compiled.GRASS Shell is not compiled.The config file (%1) not found.The config file (%1) not found.Cannot open config file (%1).Cannot open config file (%1).Cannot read config file (%1):Cannot read config file (%1):
%1
at line %2 column %3
%1
at line %2 column %3%1 errors found%1 errors found%1 errors%1 errorsQgsGrassToolsBase&GRASS Tools&GRASS Tools<html><head/><body><p>No mapset is open. You can open a GRASS mapset from the browser using the mapset item's context menu action <span style=" font-style:italic;">Open mapset</span>.</p></body></html><html><head/><body><p>No mapset is open. You can open a GRASS mapset from the browser using the mapset item's context menu action <span style=" font-style:italic;">Open mapset</span>.</p></body></html>ModulesModules……Reload treeReload treeRun debugRun debugClose debugClose debugFilterFilterQgsGrassVectorCannot open vector on level 2Cannot open vector on level 2Cannot open vectorCannot open vectorQgsGrassVectorImportWriting featuresWriting featuresQgsGrassVectorMapLayerNo field infoNo field infoVirtual topology symbol fieldVirtual topology symbol fieldDriver is not openDriver is not openThe table for this field already existsThe table for this field already existsCannot create field infoCannot create field infoCannot create link to the table.Cannot create link to the table.Created table %1 could not be deletedCreated table %1 could not be deletedErrors updating restored column, update interruptedErrors updating restored column, update interrupted%1 field cannot be deleted, it is temporary virtual field used for topology symbol.%1 field cannot be deleted, it is temporary virtual field used for topology symbol.no tableno tableTable does not existTable does not existFeature invalidFeature invalidCannot select record from tableCannot select record from tableCannot check if record existsCannot check if record existsField %1 not found in cached attributesField %1 not found in cached attributesQgsGroupWMSDataDialogBaseShort nameShort nameA name used to identify the group layer. The short name is a text string used for machine-to-machine communication.A name used to identify the group layer. The short name is a text string used for machine-to-machine communication.The title is for the benefit of humans to identify group layer.The title is for the benefit of humans to identify group layer.The abstract is a descriptive narrative providing more information about the group layer.The abstract is a descriptive narrative providing more information about the group layer.TitleTitleSet Group WMS DataSet Group WMS DataAbstractAbstractQgsGuiVectorLayerToolsAdd featureAdd featureStart editing failedStart editing failedProvider cannot be opened for editingProvider cannot be opened for editingDo you want to save the changes to layer %1?Do you want to save the changes to layer %1?ErrorErrorProblems during roll backProblems during roll backCommit ErrorsCommit ErrorsCommit errorsCommit errorsCould not commit changes to layer %1Could not commit changes to layer %1Stop EditingStop EditingErrors: %1
Errors: %1
Show moreShow moreQgsHandleBadLayersBrowseBrowseLayer nameLayer nameTypeTypeProviderProviderAuth configAuth configDatasourceDatasourcenonenoneEditEditSelect File to Replace '%1'Select File to Replace '%1'Select New Directory of Selected FilesSelect New Directory of Selected FilesPlease select exactly one file.Please select exactly one file.Unhandled layer will be lost.Unhandled layer will be lost.There are still %n unhandled layer(s), that will be lost if you closed now.unhandled layersThere are still %n unhandled layer(s), that will be lost if you closed now.There are still %n unhandled layer(s), that will be lost if you closed now.QgsHandleBadLayersBaseHandle Bad LayersHandle Bad LayersQgsHandleBadLayersHandlerHandle bad layersHandle bad layers%1 of %2 bad layers were not fixable.%1 of %2 bad layers were not fixable.QgsHeatmapRendererWidgetThe heatmap renderer only applies to point and multipoint layers.
'%1' is not a point layer and cannot be rendered as a heatmap.The heatmap renderer only applies to point and multipoint layers.
'%1' is not a point layer and cannot be rendered as a heatmap.QgsHeatmapRendererWidgetBaseFormFormAutomaticAutomaticRadiusRadiusRendering qualityRendering quality<html><head/><body><p><span style=" font-style:italic;">Best</span></p></body></html><html><head/><body><p><span style=" font-style:italic;">Best</span></p></body></html><html><head/><body><p><span style=" font-style:italic;">Fastest</span></p></body></html><html><head/><body><p><span style=" font-style:italic;">Fastest</span></p></body></html>Color rampColor rampMaximum valueMaximum valueWeight points byWeight points byQgsHillShadeWidgetFormForm˚˚AltitudeAltitudeAzimuthAzimuthZ FactorZ FactorBandBandMultidirectionalMultidirectionalQgsHillshadeRendererRenderingRenderingQgsHistogramWidgetBaseFormFormLoad ValuesLoad ValuesHistogram binsHistogram binsShow mean valueShow mean valueShow standard deviationShow standard deviationQgsHtmlAnnotationDialogHTML AnnotationHTML AnnotationDeleteDeletehtmlhtmlQgsIdentifyMenuIdentifyIdentify%1 All (%2)%1 All (%2)QgsIdentifyResultsBaseIdentify ResultsIdentify ResultsLayerLayerFIDFIDAttributeAttributeValueValueExpand New Results by DefaultExpand New Results by DefaultClear ResultsClear ResultsCopy Selected Feature to Clipboard Copy Selected Feature to Clipboard Print Selected HTML ResponsePrint Selected HTML ResponseIdentify Feature(s)Identify Feature(s)Identify Features by area or single clickIdentify Features by area or single clickIdentify Features by PolygonIdentify Features by PolygonIdentify Features by FreehandIdentify Features by FreehandIdentify Features by RadiusIdentify Features by RadiusHelpHelpSelect identify modeSelect identify modeModeModeSelect view mode for raster layersSelect view mode for raster layersViewViewAuto open formAuto open formExpand TreeExpand TreeCollapse TreeCollapse TreeExpand New ResultsExpand New ResultsOpen FormOpen FormCopy FeatureCopy FeaturePrint ResponsePrint ResponseQgsIdentifyResultsDialogIdentify ResultsIdentify ResultsFeatureFeatureValueValueCurrent layerCurrent layerTop down, stop at firstTop down, stop at firstTop downTop downLayer selectionLayer selection(Derived)(Derived)(Actions)(Actions)Edit feature formEdit feature formView feature formView feature formEdit Feature Form…Edit Feature Form…View Feature Form…View Feature Form…Zoom to FeatureZoom to FeatureCopy FeatureCopy FeatureToggle Feature SelectionToggle Feature SelectionCopy Attribute ValueCopy Attribute ValueCopy Feature AttributesCopy Feature AttributesClear ResultsClear ResultsClear HighlightsClear HighlightsHighlight AllHighlight AllHighlight LayerHighlight LayerActivate LayerActivate LayerLayer Properties…Layer Properties…Expand AllExpand AllCollapse AllCollapse AllTableTableTreeTreeGraphGraphTitleTitleFormatFormatNo attributes.No attributes.Copy GetFeatureInfo request URLCopy GetFeatureInfo request URLPrint HTML ResponsePrint HTML ResponseCannot print this item.Cannot print this item.Attributes changedAttributes changedQgsIdentifyResultsWebViewInvalid URLInvalid URLThe download URL is not valid: %1The download URL is not valid: %1Save AsSave AsPrintPrintQgsIdentifyResultsWebViewItemLoading…Loading…QgsImageWarperProgress IndicationProgress IndicationQgsInvertedPolygonRendererWidgetThe inverted polygon renderer only applies to polygon and multipolygon layers.
'%1' is not a polygon layer and then cannot be displayedThe inverted polygon renderer only applies to polygon and multipolygon layers.
'%1' is not a polygon layer and then cannot be displayedQgsInvertedPolygonRendererWidgetBaseFormFormSub rendererSub rendererMerge polygons before rendering (slow)Merge polygons before rendering (slow)QgsJoinDialogThis option allows values of the joined fields to be automatically reloaded when the "Target Field" is changedThis option allows values of the joined fields to be automatically reloaded when the "Target Field" is changedThis option allows values of the joined layers to be editable if they're themselves editableThis option allows values of the joined layers to be editable if they're themselves editableAutomatically adds a matching row to the joined table, but if one already exists then update that matching row insteadAutomatically adds a matching row to the joined table, but if one already exists then update that matching row insteadAutomatically delete the corresponding feature of the linked layer if one existsAutomatically delete the corresponding feature of the linked layer if one existsQgsJoinDialogBaseAdd Vector JoinAdd Vector JoinJoin layerJoin layerJoin fieldJoin fieldTarget fieldTarget field&Joined Fields&Joined FieldsCustom Field &Name PrefixCustom Field &Name PrefixDynamic formDynamic formEdi&table join layerEdi&table join layerUpsert on editUpsert on editDelete cascadeDelete cascadeCache join layer in virtual memoryCache join layer in virtual memoryCreate attribute index on join fieldCreate attribute index on join fieldQgsLUDialogBaseEnter Class BoundsEnter Class BoundsLower valueLower valueUpper valueUpper valueQgsLabelEngineConfigDialogAutomated Placement EngineAutomated Placement EngineSearch methodSearch methodChain (fast)Chain (fast)Popmusic TabuPopmusic TabuPopmusic ChainPopmusic ChainPopmusic Tabu ChainPopmusic Tabu ChainFALP (fastest)FALP (fastest)Number of candidatesNumber of candidatesPointPointLineLinePolygonPolygonShow candidates (for debugging)Show candidates (for debugging)Show all labels for all layers (i.e. including colliding objects)Show all labels for all layers (i.e. including colliding objects)Draw text as outlines (recommended)Draw text as outlines (recommended)Show partial labelsShow partial labelsQgsLabelPropertyDialogExpression resultExpression resultLayer default (%1)Layer default (%1)Font ColorFont ColorBuffer ColorBuffer ColorLeftLeftCenterCenterRightRightBottomBottomBaseBaseHalfHalfCapCapTopTopQgsLabelPropertyDialogBaseTextTextFontFontAvailable typeface stylesAvailable typeface stylesSizeSizeLabel PropertiesLabel PropertiesMinimum scale, i.e. most "zoomed out".Minimum scale, i.e. most "zoomed out".StyleStyleUnderlined textUnderlined textUUStrikeout textStrikeout textSSBold text
(data defined only, overrides Style)Bold text
(data defined only, overrides Style)BBItalic text
(data defined only, overrides Style)Italic text
(data defined only, overrides Style)II˚˚DisplayDisplayScale-basedScale-basedShow labelShow labelIgnores priority and permits collisions/overlapsIgnores priority and permits collisions/overlapsAlways show (exceptions above)Always show (exceptions above)BufferBufferPositionPositionLabel distanceLabel distanceX CoordinateX CoordinateY CoordinateY CoordinateHorizontal alignmentHorizontal alignmentVertical alignmentVertical alignmentRotationRotationDefaultDefaultQgsLabelingGuiIn edit mode, layer's relevant labeling map tool is:<br> Defined attribute field -> <i>enabled</i><br> Defined expression -> <i>disabled</i>In edit mode, layer's relevant labeling map tool is:<br> Defined attribute field -> <i>enabled</i><br> Defined expression -> <i>disabled</i>Value < 0 represents a scale closer than 1:1, e.g. -10 = 10:1<br>Value of 0 disables the specific limit.Value < 0 represents a scale closer than 1:1, e.g. -10 = 10:1<br>Value of 0 disables the specific limit.This option is not compatible with line direction symbols.This option is not compatible with line direction symbols.Follow label placementFollow label placementQgsLabelingRulePropsWidgetDescriptionDescriptionFilterFilterRule PropertiesRule PropertiesElseElseCatch-all for other featuresCatch-all for other featuresTestTestScale rangeScale rangeLabelsLabelsFilter expression parsing error:
Filter expression parsing error:
Test FilterTest FilterFilter returned %n feature(s)number of filtered featuresFilter returned %n feature(s)Filter returned %n feature(s)QgsLabelingWidgetNo labelsNo labelsSingle labelsSingle labelsRule-based labelingRule-based labelingBlockingBlockingAutomated placement settings (applies to all layers)Automated placement settings (applies to all layers)QgsLayerCapabilitiesModelLayerLayerIdentifiableIdentifiableRead-onlyRead-onlySearchableSearchableRequiredRequiredLayers which are protected from inadvertent removal from the project.Layers which are protected from inadvertent removal from the project.QgsLayerMetadataFormatterFeesFeesLicensesLicensesRightsRightsConstraintsConstraintsNo contact yet.No contact yet.IDIDNameNamePositionPositionOrganizationOrganizationRoleRoleEmailEmailVoiceVoiceFaxFaxAddressesAddressesCRSCRSGeographicGeographicProjectedProjectedSpatial ExtentSpatial ExtentX Minimum:X Minimum:Y Minimum:Y Minimum:X Maximum:X Maximum:Y Maximum:Y Maximum:Z Minimum:Z Minimum:Z Maximum:Z Maximum:Temporal ExtentTemporal ExtentInstant:Instant:Start:Start:End:End:IdentifierIdentifierParent IdentifierParent IdentifierTitleTitleTypeTypeLanguageLanguageAbstractAbstractCategoriesCategoriesKeywordsKeywordsVocabularyVocabularyItemsItemsNo history yet.No history yet.ActionActionNo links yet.No links yet.URLURLDescriptionDescriptionFormatFormatMIME TypeMIME TypeSizeSizeQgsLayerPropertiesWidgetOutline: %1Outline: %1QgsLayerStylingWidgetSymbologySymbologyLabelsLabels3D View3D ViewTransparencyTransparencyHistogramHistogramHistoryHistoryQgsLayerStylingWidgetBaseFormFormNot supported or no layerNot supported or no layerUndoUndo……RedoRedoIf checked, the map canvas will automatically update whenever an option has been changed without the requirement to click ApplyIf checked, the map canvas will automatically update whenever an option has been changed without the requirement to click ApplyLive updateLive updateQgsLayerTreeEmbeddedConfigWidgetBaseFormFormAvailable widgetsAvailable widgetsUsed widgetsUsed widgetsAdd selected widgetsAdd selected widgets->->Remove selected widgetsRemove selected widgets<-<-QgsLayerTreeLocatorFilterProject LayersProject LayersQgsLayerTreeModel (%1 - %2) (%1 - %2) (%1) (%1)QgsLayerTreeOpacityWidgetOpacity sliderOpacity sliderQgsLayerTreeViewBadLayerIndicatorProvider<b>Bad layer!</b><br>Layer data source could not be found.<b>Bad layer!</b><br>Layer data source could not be found.QgsLayerTreeViewDefaultActions&Add Group&Add Group&Remove&Remove&Show in Overview&Show in OverviewRe&name GroupRe&name GroupRe&name LayerRe&name LayerShow Feature CountShow Feature Count&Zoom to Layer&Zoom to Layer&Zoom to Selection&Zoom to Selection&Zoom to Group&Zoom to Group&Move to Top-level&Move to Top-levelMove Out of &GroupMove Out of &GroupMove to &TopMove to &Top&Group Selected&Group SelectedMutually Exclusive GroupMutually Exclusive GroupCheck and All its Children (⌘-click)Check and All its Children (⌘-click)Check and All its Children (Ctrl-click)Check and All its Children (Ctrl-click)Uncheck and All its Children (⌘-click)Uncheck and All its Children (⌘-click)Uncheck and All its Children (Ctrl-click)Uncheck and All its Children (Ctrl-click)Check and All its ParentsCheck and All its ParentsQgsLayerTreeViewEmbeddedIndicatorProviderEmbedded from <b>%1</b>Embedded from <b>%1</b>QgsLayerTreeViewFilterIndicatorProviderFilterFilterQgsLayerTreeViewMemoryIndicatorProvider<b>Temporary scratch layer only!</b><br>Contents will be discarded after closing this project<b>Temporary scratch layer only!</b><br>Contents will be discarded after closing this projectQgsLayerTreeViewNonRemovableIndicatorProviderLayer required by the projectLayer required by the projectQgsLayoutCreate %1Create %1Create ItemCreate ItemDelete ItemsDelete ItemsDelete ItemDelete ItemGroup ItemsGroup ItemsUngroup ItemsUngroup ItemsChange Item StackingChange Item StackingQgsLayout3DMapWidgetBase3D Map3D MapCopy Settings from a 3D View...Copy Settings from a 3D View...Scene SettingsScene SettingsCamera PoseCamera PoseCenter XCenter XCenter ZCenter ZCenter YCenter Y ° °HeadingHeadingPitchPitchDistanceDistanceSet from a 3D View...Set from a 3D View...QgsLayoutAddPagesDialogPortraitPortraitLandscapeLandscapeCustomCustomQgsLayoutAppMenuProviderGroupGroupUngroupUngroupCopyCopyCutCutPastePastePage Properties…Page Properties…Remove PageRemove PageRemove page from layout?Remove page from layout?Item Properties…Item Properties…QgsLayoutAtlasAtlas name eval error: %1Atlas name eval error: %1LayoutLayoutAtlas sort eval error: %1Atlas sort eval error: %1Atlas filename evaluation error: %1Atlas filename evaluation error: %1No matching atlas featuresNo matching atlas featuresAtlas feature %1 of %2Atlas feature %1 of %2QgsLayoutAtlasWidgetChange Atlas LayerChange Atlas LayerChange Atlas FilenameChange Atlas FilenameAtlasAtlasCould not set filename expression to '%1'.
Parser error:
%2Could not set filename expression to '%1'.
Parser error:
%2Expression Based FilenameExpression Based FilenameToggle Atlas LayerToggle Atlas LayerToggle Atlas SortingToggle Atlas SortingChange Atlas SortChange Atlas SortNo matching atlas features found!No matching atlas features found!Change Atlas FilterChange Atlas FilterChange Atlas NameChange Atlas NameCould not set filter expression to '%1'.
Parser error:
%2Could not set filter expression to '%1'.
Parser error:
%2Expression Based FilterExpression Based FilterQgsLayoutAtlasWidgetBaseAtlas GenerationAtlas GenerationGenerate an atlasGenerate an atlasConfigurationConfigurationSort directionSort direction……Filter withFilter withHidden coverage layerHidden coverage layerCoverage layer Coverage layer Page namePage nameSort bySort byOutputOutputSingle file export when possibleSingle file export when possibleImage export formatImage export formatOutput filename expressionOutput filename expressionQgsLayoutAttributeSelectionDialogAscendingAscendingDescendingDescendingQgsLayoutAttributeSelectionDialogBaseSelect AttributesSelect AttributesColumnsColumnsResetResetClearClearSortingSortingQgsLayoutAttributeTableColumnModelTop centerTop centerBottom centerBottom centerMiddle centerMiddle centerTop rightTop rightBottom rightBottom rightMiddle rightMiddle rightTop leftTop leftBottom leftBottom leftMiddle leftMiddle leftAutomaticAutomatic%1 mm%1 mmAttributeAttributeHeadingHeadingAlignmentAlignmentWidthWidthQgsLayoutAttributeTableWidgetTable PropertiesTable PropertiesUse existing framesUse existing framesExtend to next pageExtend to next pageRepeat until finishedRepeat until finishedDraw headers onlyDraw headers onlyHide entire tableHide entire tableShow set messageShow set messageTruncate textTruncate textWrap textWrap textLayer featuresLayer featuresSelect Header Font ColorSelect Header Font ColorSelect Content Font ColorSelect Content Font ColorSelect Grid ColorSelect Grid ColorSelect Background ColorSelect Background ColorNo BackgroundNo BackgroundShow only features intersecting %1 featureShow only features intersecting %1 featureChange Table AttributesChange Table AttributesChange Table MapChange Table MapChange Table RowsChange Table RowsChange Table MarginChange Table MarginChange Table FontChange Table FontChange Font ColorChange Font ColorChange Table Line WidthChange Table Line WidthChange Table Grid ColorChange Table Grid ColorToggle Table GridToggle Table GridToggled Table GridToggled Table GridChange Table ColorChange Table ColorCurrent atlas featureCurrent atlas featureRelation childrenRelation childrenToggle Visible Features OnlyToggle Visible Features OnlyToggle Table Filter DuplicatesToggle Table Filter DuplicatesToggle Empty Frame ModeToggle Empty Frame ModeToggle Background DisplayToggle Background DisplayToggle Table Atlas FilterToggle Table Atlas FilterToggle Table Feature FilterToggle Table Feature FilterChange Table Feature FilterChange Table Feature FilterExpression Based FilterExpression Based FilterChange Table AlignmentChange Table AlignmentChange Table Header ModeChange Table Header ModeChange Table Wrap StringChange Table Wrap StringChange Table LayerChange Table LayerChange Resize ModeChange Resize ModeChange Table SourceChange Table SourceChange Table Source RelationChange Table Source RelationChange Empty Table BehaviorChange Empty Table BehaviorChange Table Wrap ModeChange Table Wrap ModeChange Show Empty RowsChange Show Empty RowsChange Empty Table MessageChange Empty Table MessageQgsLayoutAttributeTableWidgetBaseAttribute TableAttribute TableAttribute tableAttribute tableSourceSourceLayerLayerRelationRelationAttributes...Attributes...Maximum rowsMaximum rowsRemove duplicate rows from tableRemove duplicate rows from tableShow only features visible within a mapShow only features visible within a mapLinked mapLinked mapShow only features intersecting atlas featureShow only features intersecting atlas featureFilter withFilter with……Main PropertiesMain PropertiesRefresh Table DataRefresh Table DataFeature FilteringFeature FilteringAppearanceAppearanceOversized textOversized textWrap text onWrap text onOn first frameOn first frameOn all framesOn all framesNo headerNo headerDisplay headerDisplay headerMessage to displayMessage to displayEmpty tablesEmpty tables mm mmShow empty rowsShow empty rowsBackground colorBackground colorCell marginsCell marginsAdvanced Customization...Advanced Customization...Show GridShow GridFonts and Text StylingFonts and Text StylingTable HeadingTable HeadingTable ContentsTable ContentsLine widthLine widthColorColorDraw horizontal linesDraw horizontal linesDraw vertical linesDraw vertical linesAlignmentAlignmentFollow column alignmentFollow column alignmentLeftLeftCenterCenterRightRightFontFontHeading fontHeading fontContents fontContents fontFramesFramesResize modeResize modeAdd FrameAdd FrameDon't export page if frame is emptyDon't export page if frame is emptyDon't draw background if frame is emptyDon't draw background if frame is emptyQgsLayoutColumnAlignmentDelegateTop leftTop leftTop centerTop centerTop rightTop rightMiddle leftMiddle leftMiddle centerMiddle centerMiddle rightMiddle rightBottom leftBottom leftBottom centerBottom centerBottom rightBottom rightQgsLayoutColumnSortOrderDelegateAscendingAscendingDescendingDescendingQgsLayoutColumnWidthDelegate mm mmAutomaticAutomaticQgsLayoutDesignerBaseToolboxToolbox&Layout&LayoutLayoutsLayouts&Add Item&Add Item&View&View&Toolbars&Toolbars&Panels&Panels&Preview&Preview&Edit&Edit&Items&Items&Align Items&Align Items&Distribute Items&Distribute ItemsRe&sizeRe&sizeAtlasAtlasReportReportSettingsSettingsMain WindowMain WindowLayout ToolbarLayout ToolbarNavigation ToolbarNavigation ToolbarActions ToolbarActions ToolbarAtlas ToolbarAtlas ToolbarReport ToolbarReport Toolbar&Close&CloseClose designerClose designerCtrl+QCtrl+QPan LayoutPan LayoutPPZoomZoomZZSelect/Move ItemSelect/Move ItemSelect/Move itemSelect/Move itemVVZoom &FullZoom &FullZoom fullZoom fullCtrl+0Ctrl+0Zoom &InZoom &InZoom inZoom inCtrl++Ctrl++Zoom &OutZoom &OutZoom outZoom outCtrl+-Ctrl+-Zoom to &100%Zoom to &100%Zoom to 100%Zoom to 100%Ctrl+1Ctrl+1Zoom to WidthZoom to WidthShow Ru&lersShow Ru&lersShow rulersShow rulersCtrl+RCtrl+RToggle Full Scr&eenToggle Full Scr&eenToggle full screen modeToggle full screen modeF11F11Add Pages…Add Pages…Show &GridShow &GridShow gridShow gridCtrl+'Ctrl+'S&nap to GridS&nap to GridSnap to gridSnap to gridCtrl+Shift+'Ctrl+Shift+'Manage Guides…Manage Guides…Show G&uidesShow G&uidesShow guidesShow guidesCtrl+;Ctrl+;&Snap to Guides&Snap to GuidesSnap to guidesSnap to guidesCtrl+Shift+;Ctrl+Shift+;&Clear Guides&Clear GuidesClear guidesClear guidesLayout Properties…Layout Properties…Show Bounding BoxesShow Bounding BoxesShow bounding boxesShow bounding boxesCtrl+Shift+BCtrl+Shift+BS&mart GuidesS&mart GuidesSmart guidesSmart guidesCtrl+Alt+;Ctrl+Alt+;D&eselect AllD&eselect AllDeselect allDeselect allCtrl+Shift+ACtrl+Shift+A&Select All&Select AllSelect all itemsSelect all itemsCtrl+ACtrl+A&Invert Selection&Invert SelectionInvert selectionInvert selectionSelect Next Item &BelowSelect Next Item &BelowSelect next item belowSelect next item belowCtrl+Alt+[Ctrl+Alt+[Select Next Item &AboveSelect Next Item &AboveSelect next item aboveSelect next item aboveCtrl+Alt+]Ctrl+Alt+]Loc&k Selected ItemsLoc&k Selected ItemsCtrl+LCtrl+LUnl&ock AllUnl&ock AllUnlock All ItemsUnlock All ItemsCtrl+Shift+LCtrl+Shift+LToggle Panel &VisibilityToggle Panel &VisibilityHide panelsHide panelsCtrl+TabCtrl+Tab&Raise&RaiseRaise selected itemsRaise selected itemsCtrl+]Ctrl+]&Lower&LowerLower selected itemsLower selected itemsCtrl+[Ctrl+[Bring to &FrontBring to &FrontMove selected items to topMove selected items to topCtrl+Shift+]Ctrl+Shift+]Send to &BackSend to &BackMove selected items to bottomMove selected items to bottomCtrl+Shift+[Ctrl+Shift+[Align &LeftAlign &LeftAlign selected items leftAlign selected items leftAlign &CenterAlign &CenterAlign center horizontalAlign center horizontalAlign &RightAlign &RightAlign selected items rightAlign selected items rightAlign &TopAlign &TopAlign selected items to topAlign selected items to topAlign Center &VerticalAlign Center &VerticalAlign center verticalAlign center verticalAlign &BottomAlign &BottomAlign selected items bottomAlign selected items bottomDistribute &Left EdgesDistribute &Left EdgesDistributes left edges of items equidistantlyDistributes left edges of items equidistantlyDistribute &CentersDistribute &CentersDistributes horizontal centers of items equidistantlyDistributes horizontal centers of items equidistantlyDistribute &Right EdgesDistribute &Right EdgesDistributes right edges of items equidistantlyDistributes right edges of items equidistantlyDistribute &Top EdgesDistribute &Top EdgesDistributes top edges of items equidistantlyDistributes top edges of items equidistantlyDistribute &Vertical CentersDistribute &Vertical CentersDistributes vertical centers of items equidistantlyDistributes vertical centers of items equidistantlyDistribute &Bottom EdgesDistribute &Bottom EdgesDistributes bottom edges of items equidistantlyDistributes bottom edges of items equidistantlyResize to &NarrowestResize to &NarrowestResizes item width to match the narrowest selected itemResizes item width to match the narrowest selected itemResize to &WidestResize to &WidestResizes item width to match the widest selected itemResizes item width to match the widest selected itemResize to &ShortestResize to &ShortestResizes item height to match the shortest selected itemResizes item height to match the shortest selected itemResize to &TallestResize to &TallestResizes item height to match the tallest selected itemResizes item height to match the tallest selected item&Delete&DeleteDelete selected itemsDelete selected itemsDelDelResize to S&quareResize to S&quareResizes items to squaresResizes items to squares&Normal&NormalNormalNormalSimulate Photocopy (&Grayscale)Simulate Photocopy (&Grayscale)Simulate Fax (&Mono)Simulate Fax (&Mono)Simulate Color Blindness (&Protanope)Simulate Color Blindness (&Protanope)Simulate Color Blindness (&Deuteranope)Simulate Color Blindness (&Deuteranope)Show PagesShow PagesShow pagesShow pages&Group&GroupGroup itemsGroup itemsCtrl+GCtrl+G&Ungroup&UngroupUngroup itemsUngroup itemsCtrl+Shift+GCtrl+Shift+G&Refresh&RefreshRefresh viewRefresh viewF5F5Edit Nodes ItemEdit Nodes ItemMove &ContentMove &ContentMove item contentMove item contentCCPaste in P&lacePaste in P&lacePaste in placePaste in placeCtrl+Shift+VCtrl+Shift+VSave as &Template…Save as &Template…Save as templateSave as template&Add Items from Template…&Add Items from Template…Add items from templateAdd items from template&Duplicate Layout…&Duplicate Layout…Duplicate layoutDuplicate layout&Save Project&Save ProjectSave projectSave projectCtrl+SCtrl+S&New Layout…&New Layout…New layoutNew layoutCtrl+NCtrl+NLayout &Manager...Layout &Manager...Layout managerLayout managerRename Layout…Rename Layout…Rename layoutRename layoutDelete Layout…Delete Layout…Delete layoutDelete layoutExport as &Image…Export as &Image…Export as imageExport as image&Export as PDF…&Export as PDF…Export as S&VG…Export as S&VG…&First Feature&First FeatureCtrl+<Ctrl+<P&revious FeatureP&revious FeatureCtrl+,Ctrl+,&Next Feature&Next FeatureCtrl+.Ctrl+.&Last Feature&Last FeatureCtrl+>Ctrl+>&Print Atlas...&Print Atlas...Export Atlas as &Images...Export Atlas as &Images...Export Atlas as S&VG...Export Atlas as S&VG...&Export Atlas as PDF...&Export Atlas as PDF...Export Atlas as PDFExport Atlas as PDFAtlas &SettingsAtlas &SettingsPreview &AtlasPreview &AtlasCtrl+Alt+/Ctrl+Alt+/Export Report as &Images...Export Report as &Images...Export Report as ImagesExport Report as ImagesExport Report as S&VG...Export Report as S&VG...Export Report as SVGExport Report as SVG&Export Report as PDF...&Export Report as PDF...Export Report as PDFExport Report as PDFReport &SettingsReport &SettingsReport SettingsReport Settings&Print...&Print...Print LayoutPrint LayoutCtrl+PCtrl+P&Print Report...&Print Report...Print ReportPrint ReportPa&ge Setup…Pa&ge Setup…Page setupPage setupCtrl+Shift+PCtrl+Shift+PLayout &Options…Layout &Options…Layout OptionsLayout OptionsQgsLayoutDesignerDialogQGIS Layout DesignerQGIS Layout DesignerExport AtlasExport AtlasCu&tCu&tCutCut&Copy&CopyCopyCopy&Paste&PastePastePaste%1%%1%Fit LayoutFit LayoutFit Layout WidthFit Layout WidthZoom levelZoom levelLayoutLayoutGuidesGuidesItemsItemsAtlasAtlasItem PropertiesItem PropertiesReport OrganizerReport OrganizerAdd %1Add %1Adds a new %1 to the layoutAdds a new %1 to the layoutx: %1 %2x: %1 %2y: %1 %2y: %1 %2page: %1page: %1Add PagesAdd PagesSave templateSave templateLayout templatesLayout templatesError creating template file.Error creating template file.Save TemplateSave TemplateLoad templateLoad templateCould not read template file.Could not read template file.%1 copy%1 copyDuplicating layout…Duplicating layout…Save Report AsSave Report AsDuplicate layoutDuplicate layoutLayout duplication failed.Layout duplication failed.Delete LayoutDelete LayoutAre you sure you want to delete the layout “%1”?Are you sure you want to delete the layout “%1”?Print layoutPrint layoutMemory Allocation ErrorMemory Allocation ErrorPrinting the layout resulted in a memory overflow.
Please try a lower resolution or a smaller paper size.Printing the layout resulted in a memory overflow.
Please try a lower resolution or a smaller paper size.Export layoutExport layoutSuccessfully exported layout to <a href="%1">%2</a>Successfully exported layout to <a href="%1">%2</a>Image Export ErrorImage Export ErrorCannot write to %1.
This file may be open in another application.Cannot write to %1.
This file may be open in another application.Trying to create image %1 (%2×%3 @ %4dpi ) resulted in a memory overflow.
Please try a lower resolution or a smaller paper size.Trying to create image %1 (%2×%3 @ %4dpi ) resulted in a memory overflow.
Please try a lower resolution or a smaller paper size.Export to PDFExport to PDFPDF FormatPDF FormatCould not create print device.Could not create print device.Undo HistoryUndo History%1 Panel%1 PanelLoad from TemplateLoad from TemplateDuplicate LayoutDuplicate LayoutSuccessfully printed layout to %1.Successfully printed layout to %1.Successfully printed layout.Successfully printed layout.Could not create print device for %1.Could not create print device for %1.Print LayoutPrint LayoutExporting the PDF resulted in a memory overflow.
Please try a lower resolution or a smaller paper size.Exporting the PDF resulted in a memory overflow.
Please try a lower resolution or a smaller paper size.Export to SVGExport to SVGSVG FormatSVG FormatCannot create layered SVG file %1.Cannot create layered SVG file %1.Exporting the SVG resulted in a memory overflow.
Please try a lower resolution or a smaller paper size.Exporting the SVG resulted in a memory overflow.
Please try a lower resolution or a smaller paper size.Atlas is not enabled for this layout!Atlas is not enabled for this layout!No matching atlas features found!No matching atlas features found!AbortAbortPrinting maps…Printing maps…Printing AtlasPrinting AtlasPrint atlasPrint atlasPrint AtlasPrint AtlasThe filename expression is empty. A default one will be used instead.The filename expression is empty. A default one will be used instead.Export Atlas to DirectoryExport Atlas to DirectoryExporting AtlasExporting AtlasExport atlasExport atlasSuccessfully exported atlas to <a href="%1">%2</a>Successfully exported atlas to <a href="%1">%2</a>Error encountered while exporting atlasError encountered while exporting atlasTrying to create image of %2×%3 @ %4dpi resulted in a memory overflow.
Please try a lower resolution or a smaller paper size.Trying to create image of %2×%3 @ %4dpi resulted in a memory overflow.
Please try a lower resolution or a smaller paper size.PanelsPanelsToolbarsToolbarsPrinting “%1”Printing “%1”Save Layout AsSave Layout AsExporting “%1”Exporting “%1”Successfully printed atlas to %1.Successfully printed atlas to %1.Successfully printed atlas.Successfully printed atlas.Error encountered while printing atlas.Error encountered while printing atlas.Export Atlas as ImageExport Atlas as ImageUnable to write into the given output directory. Canceling.Unable to write into the given output directory. Canceling.Rendering maps…Rendering maps…Error encountered while exporting atlas.Error encountered while exporting atlas.Export Atlas as SVGExport Atlas as SVGCannot create layered SVG file.Cannot create layered SVG file.Exporting ReportExporting ReportExport reportExport reportSuccessfully exported report to <a href="%1">%2</a>Successfully exported report to <a href="%1">%2</a>Error encountered while exporting reportError encountered while exporting reportPrinting ReportPrinting ReportPrint reportPrint reportPrinting the report resulted in a memory overflow.
Please try a lower resolution or a smaller paper size.Printing the report resulted in a memory overflow.
Please try a lower resolution or a smaller paper size.Print ReportPrint ReportExport Atlas as PDFExport Atlas as PDFRendering report…Rendering report…Export Report as ImageExport Report as ImageExport Report as SVGExport Report as SVGError encountered while exporting report.Error encountered while exporting report.Export Report as PDFExport Report as PDFSuccessfully printed report to %1.Successfully printed report to %1.Successfully printed report.Successfully printed report.Error encountered while printing report.Error encountered while printing report.Project Contains WMS LayersProject Contains WMS LayersSome WMS servers (e.g. UMN mapserver) have a limit for the WIDTH and HEIGHT parameter. Printing layers from such servers may exceed this limit. If this is the case, the WMS layer will not be printedSome WMS servers (e.g. UMN mapserver) have a limit for the WIDTH and HEIGHT parameter. Printing layers from such servers may exceed this limit. If this is the case, the WMS layer will not be printedDon't show this message againDon't show this message againExport as SVGExport as SVG<p>The SVG export function in QGIS has several problems due to bugs and deficiencies in the <p>The SVG export function in QGIS has several problems due to bugs and deficiencies in the underlying Qt SVG library. In particular, there are problems with layers not being clipped to the map bounding box.</p>underlying Qt SVG library. In particular, there are problems with layers not being clipped to the map bounding box.</p>If you require a vector-based output file from QGIS it is suggested that you try exporting to PDF if the SVG output is not satisfactory.</p>If you require a vector-based output file from QGIS it is suggested that you try exporting to PDF if the SVG output is not satisfactory.</p>Composition EffectsComposition EffectsAdvanced composition effects such as blend modes or vector layer transparency are enabled in this layout, which cannot be printed as vectors. Printing as a raster is recommended.Advanced composition effects such as blend modes or vector layer transparency are enabled in this layout, which cannot be printed as vectors. Printing as a raster is recommended.Print as rasterPrint as rasterForce VectorForce VectorThis layout has the "Always export as vectors" option enabled, but the layout contains effects such as blend modes or vector layer transparency, which cannot be printed as vectors. The generated file will differ from the layout contents.This layout has the "Always export as vectors" option enabled, but the layout contains effects such as blend modes or vector layer transparency, which cannot be printed as vectors. The generated file will differ from the layout contents.Never show this message againNever show this message againExport LayoutExport LayoutTo create an image of %1x%2 requires about %3 MB of memory. Proceed?To create an image of %1x%2 requires about %3 MB of memory. Proceed?atlasatlasreportreport&Duplicate Layout…&Duplicate Layout…Delete Layout…Delete Layout…Delete layoutDelete layoutRename Layout…Rename Layout…Rename layoutRename layoutNew Layout…New Layout…New layoutNew layout&Duplicate Report…&Duplicate Report…Duplicate reportDuplicate reportDelete Report…Delete Report…Delete reportDelete reportRename Report…Rename Report…Rename reportRename reportNew Report…New Report…New reportNew reportQgsLayoutFrame<Frame><Frame>QgsLayoutGuideCollectionMove GuideMove GuideRemove Guide(s)Remove Guide(s)Create GuideCreate GuideClear GuidesClear GuidesApply GuidesApply GuidesChange Guide VisibilityChange Guide VisibilityQgsLayoutGuideWidgetGuidesGuidesRemove Horizontal GuidesRemove Horizontal GuidesRemove Vertical GuidesRemove Vertical GuidesGuides for page %1Guides for page %1Remove All GuidesRemove All GuidesQgsLayoutGuideWidgetBaseCompositionCompositionGuides for page 1Guides for page 1Horizontal GuidesHorizontal GuidesAdd new guideAdd new guideRemove selected guideRemove selected guideVertical GuidesVertical GuidesResets all other pages' guides to match this pageResets all other pages' guides to match this pageApply to All PagesApply to All PagesRemoves all guides from the current pageRemoves all guides from the current pageClear All GuidesClear All GuidesQgsLayoutHtmlWidgetHTML PropertiesHTML PropertiesUse existing framesUse existing framesExtend to next pageExtend to next pageRepeat on every pageRepeat on every pageRepeat until finishedRepeat until finishedChange HTML UrlChange HTML UrlSelect HTML documentSelect HTML documentChange Resize ModeChange Resize ModeChange Evaluate ExpressionsChange Evaluate ExpressionsChange Smart BreaksChange Smart BreaksChange Page Break DistanceChange Page Break DistanceChange HTMLChange HTMLChange User StylesheetChange User StylesheetToggle User StylesheetToggle User StylesheetToggle Empty Frame ModeToggle Empty Frame ModeToggle Hide BackgroundToggle Hide BackgroundChange HTML SourceChange HTML SourceInsert ExpressionInsert ExpressionQgsLayoutHtmlWidgetBaseHTML FrameHTML FrameHTML frameHTML frameHTML SourceHTML SourceIf checked, expressions inside [% %] tags will be evaluated prior to rendering the HTMLIf checked, expressions inside [% %] tags will be evaluated prior to rendering the HTMLEvaluate QGIS expressions in HTML sourceEvaluate QGIS expressions in HTML sourceRefresh HTMLRefresh HTML……SourceSourceURLURLInsert an ExpressionInsert an ExpressionUse Smart Page BreaksUse Smart Page BreaksUser StylesheetUser StylesheetFramesFramesDon't export page if frame is emptyDon't export page if frame is emptyAdd FrameAdd FrameResize modeResize modeDon't draw background if frame is emptyDon't draw background if frame is emptyMaximum distanceMaximum distance mm mmUpdate HTMLUpdate HTMLQgsLayoutImageExportOptionsDialogImage Export OptionsImage Export OptionsExport resolutionExport resolutionPage heightPage height dpi dpiAutoAuto px pxPage widthPage widthExport OptionsExport OptionsCrop to ContentCrop to ContentLeftLeftRightRightBottomBottomTop marginTop marginIf checked, a separate world file which georeferences exported images will be createdIf checked, a separate world file which georeferences exported images will be createdGenerate world fileGenerate world fileIf unchecked, the generated images will not be antialiasedIf unchecked, the generated images will not be antialiasedEnable antialiasingEnable antialiasingQgsLayoutItem<%1><%1><item><item>Change Item IDChange Item IDShow ItemShow ItemHide ItemHide ItemLock ItemLock ItemUnlock ItemUnlock ItemQgsLayoutItem3DMap3D Map %13D Map %1Scene not setScene not setLoadingLoadingQgsLayoutItemAttributeTable<Attribute table frame><Attribute table frame>QgsLayoutItemGroup<Group><Group>Set Group VisibilitySet Group VisibilityMove groupMove groupResize GroupResize GroupQgsLayoutItemHtmlLayout HTML itemLayout HTML item<HTML frame><HTML frame>QgsLayoutItemLabelLayout label itemLayout label item<HTML Label><HTML Label><Label><Label>%1…%1…QgsLayoutItemLegend<Legend><Legend>%1…%1…QgsLayoutItemMapMap %1Map %1Grid %1Grid %1Overview %1Overview %1Rendering mapRendering mapMap SettingsMap SettingsQgsLayoutItemMapGridGridGridQgsLayoutItemPicturePicture expression eval errorPicture expression eval errorQgsLayoutItemPolygon<Polygon><Polygon>QgsLayoutItemPolyline<Polyline><Polyline>QgsLayoutItemPropertiesWidgetLayout ItemLayout ItemChange Frame ColorChange Frame ColorChange Background ColorChange Background ColorMove ItemMove ItemChange Item ReferenceChange Item ReferenceResize ItemResize ItemChange Frame Stroke WidthChange Frame Stroke WidthChange Frame Join StyleChange Frame Join StyleEnable FrameEnable FrameDisable FrameDisable FrameEnable BackgroundEnable BackgroundDisable BackgroundDisable BackgroundSelect Background ColorSelect Background ColorSelect Frame ColorSelect Frame ColorChange Blend ModeChange Blend ModeChange OpacityChange OpacityChange Item IDChange Item IDRotateRotateExclude from ExportsExclude from ExportsInclude in ExportsInclude in ExportsQgsLayoutItemShape<Ellipse><Ellipse><Rectangle><Rectangle><Triangle><Triangle><Shape><Shape>QgsLayoutItemTextTable<Text table frame><Text table frame>QgsLayoutItemWidgetBaseGlobal OptionsGlobal OptionsPosition and SizePosition and SizeYY……PagePageHeightHeightLock aspect ratio (including while drawing extent onto canvas)Lock aspect ratio (including while drawing extent onto canvas)XXWidthWidthReference pointReference pointRotationRotation ° °FrameFrameColorColorThicknessThicknessJoin styleJoin styleBackgroundBackgroundItem IDItem IDIdIdRenderingRenderingBlending modeBlending modeExclude item from exportsExclude item from exportsOpacityOpacityVariablesVariablesQgsLayoutItemsListViewCopy ItemCopy ItemDelete ItemDelete ItemItem Properties…Item Properties…QgsLayoutLabelWidgetLabel PropertiesLabel PropertiesSelect Font ColorSelect Font ColorChange Label ModeChange Label ModeChange Label TextChange Label TextChange Label FontChange Label FontChange Label AlignmentChange Label AlignmentChange Label MarginChange Label MarginChange Label ColorChange Label ColorInsert ExpressionInsert ExpressionInsert expressionInsert expressionQgsLayoutLabelWidgetBaseLabel OptionsLabel OptionsLabelLabelRender as HTMLRender as HTMLMain PropertiesMain PropertiesInsert an Expression...Insert an Expression...AppearanceAppearanceHorizontal alignmentHorizontal alignment mm mmTopTopMiddleMiddleBottomBottomVertical marginVertical marginHorizontal marginHorizontal marginFont colorFont colorLeftLeftJustifyJustifyRightRightCenterCenterVertical alignmentVertical alignmentFontFontQgsLayoutLegendLayersDialogBaseAdd Layer to LegendAdd Layer to LegendSearchSearchIf checked, only layers visible within the map will be listedIf checked, only layers visible within the map will be listedShow visible layers onlyShow visible layers onlyQgsLayoutLegendWidgetLegend PropertiesLegend PropertiesSelect Font ColorSelect Font ColorSelect Stroke ColorSelect Stroke ColorChange Legend WrapChange Legend WrapChange Legend TitleChange Legend TitleChange Title AlignmentChange Title AlignmentChange Column CountChange Column CountSplit Legend LayersSplit Legend LayersLegend Column WidthLegend Column WidthResize Symbol WidthResize Symbol WidthResize Symbol HeightResize Symbol HeightResize WMS WidthResize WMS WidthResize WMS HeightResize WMS HeightChange Title SpaceChange Title SpaceChange Group SpaceChange Group SpaceChange Layer SpaceChange Layer SpaceChange Symbol SpaceChange Symbol SpaceChange Label SpaceChange Label SpaceChange Title FontChange Title FontChange Group FontChange Group FontChange Layer FontChange Layer FontChange Item FontChange Item FontChange Font ColorChange Font ColorChange Box SpaceChange Box SpaceChange Column SpaceChange Column SpaceChange Line SpaceChange Line SpaceMoved Legend Item DownMoved Legend Item DownMove Legend Item UpMove Legend Item UpChange Auto UpdateChange Auto UpdateChange Legend MapChange Legend MapResize Legend to ContentsResize Legend to ContentsChange Legend BordersChange Legend BordersResize Legend BordersResize Legend BordersChange Legend Border ColorChange Legend Border ColorAdd Legend Item(s)Add Legend Item(s)Remove Legend ItemRemove Legend ItemUpdate LegendUpdate LegendAdd Legend GroupAdd Legend GroupGroupGroupOnly show items inside current %1 featureOnly show items inside current %1 featureFilter out legend elements that lie outside the current %1 feature.Filter out legend elements that lie outside the current %1 feature.Legend item propertiesLegend item propertiesItem textItem textEdit Legend ItemEdit Legend ItemQgsLayoutLegendWidgetBaseLegend OptionsLegend OptionsLegendLegend&Title&TitleTitle alignmentTitle alignmentMapMapResize to fit contentsResize to fit contentsWrap text onWrap text on……LeftLeftCenterCenterRightRightAuto updateAuto updateUpdate whole legend. Layers are added/removed according to main application legend. User defined labels will be deleted.Update whole legend. Layers are added/removed according to main application legend. User defined labels will be deleted.Update allUpdate allAdd groupAdd groupShow feature count for each class of vector layer.Show feature count for each class of vector layer.Main PropertiesMain PropertiesLegend ItemsLegend ItemsKeeps the legend contents synchronized with the main application legend. Customization is not possible and must be done in the main application.Keeps the legend contents synchronized with the main application legend. Customization is not possible and must be done in the main application.Filter Legend by Map ContentFilter Legend by Map ContentFilter out legend elements that lie outside the current atlas feature.Filter out legend elements that lie outside the current atlas feature.Only show items inside current atlas featureOnly show items inside current atlas featureFontsFontsTitle fontTitle fontGroup fontGroup fontSubgroup fontSubgroup fontItem fontItem fontFont colorFont colorColumnsColumnsCountCountEqual column widthsEqual column widthsAllow splitting layer items into multiple columns.Allow splitting layer items into multiple columns.Split layersSplit layersSymbolSymbolSymbol widthSymbol width mm mmSymbol heightSymbol heightDraw stroke for raster symbolsDraw stroke for raster symbolsStroke colorStroke colorThicknessThicknessHairlineHairlineWMS LegendGraphicWMS LegendGraphicLegend widthLegend widthLegend heightLegend heightSpacingSpacingSpace above text using group style.Space above text using group style.Group spaceGroup spaceSpace above text using subgroup style.Space above text using subgroup style.Subgroup spaceSubgroup spaceSpace above symbol and symbol label.Space above symbol and symbol label.Symbol spaceSymbol spaceSpace between symbol icon and symbol label (symbol label left margin).Space between symbol icon and symbol label (symbol label left margin).Icon label spaceIcon label spaceBox spaceBox spaceColumn spaceColumn spaceLine spaceLine spaceSpace below title.Space below title.Title spaceTitle spaceQgsLayoutLocatorFilterProject LayoutsProject LayoutsQgsLayoutManagerLayout %1Layout %1Report %1Report %1QgsLayoutManagerBaseLayout ManagerLayout Manager&Duplicate…&Duplicate…Re&name…Re&name…&Remove…&Remove…&Show&ShowNew from TemplateNew from TemplateCreate…Create…Open template directoryOpen template directoryUserUserDefaultDefaultQgsLayoutManagerDialogLayout templatesLayout templatesSelect a TemplateSelect a TemplateEmpty layoutEmpty layoutEmpty reportEmpty reportSpecificSpecificOpen DirectoryOpen DirectoryRemove LayoutRemove LayoutRemove LayoutsRemove LayoutsDuplicate LayoutDuplicate LayoutTemplate file “%1” not found.Template file “%1” not found.Create LayoutCreate LayoutCould not read template file “%1”.Could not read template file “%1”.Invalid template file “%1”.Invalid template file “%1”.Could not open or create local directory “%1”.Could not open or create local directory “%1”.Do you really want to remove the print layout “%1”?Do you really want to remove the print layout “%1”?Do you really want to remove all selected print layouts?Do you really want to remove all selected print layouts?%1 copy%1 copyDuplicating layout…Duplicating layout…Layout duplication failed.Layout duplication failed.QgsLayoutManagerModelThere is already a layout named “%1”.There is already a layout named “%1”.Rename LayoutRename LayoutQgsLayoutMapGridWidgetMap Grid PropertiesMap Grid PropertiesSolidSolidCrossCrossMarkersMarkersFrame and annotations onlyFrame and annotations onlyDecimalDecimalDecimal with suffixDecimal with suffixDegree, minuteDegree, minuteDegree, minute with suffixDegree, minute with suffixDegree, minute alignedDegree, minute alignedDegree, minute, secondDegree, minute, secondDegree, minute, second with suffixDegree, minute, second with suffixDegree, minute, second alignedDegree, minute, second alignedCustomCustomSelect Font ColorSelect Font ColorSelect Grid Frame ColorSelect Grid Frame ColorSelect Grid Frame Fill ColorSelect Grid Frame Fill ColorTransparent FrameTransparent FrameTransparent FillTransparent FillChange Frame DivisionsChange Frame DivisionsChange Annotation FormatChange Annotation FormatShow allShow allShow latitude onlyShow latitude onlyShow longitude onlyShow longitude onlyInside frameInside frameOutside frameOutside frameHorizontalHorizontalVertical ascendingVertical ascendingVertical descendingVertical descendingDisabledDisabledChange Annotation PositionChange Annotation PositionChange Annotation DirectionChange Annotation DirectionAllAllLatitude/Y onlyLatitude/Y onlyLongitude/X onlyLongitude/X onlyMap unitMap unitMillimeterMillimeterCentimeterCentimeterChange…Change…Change Grid IntervalChange Grid IntervalChange Grid OffsetChange Grid OffsetChange Cross WidthChange Cross WidthChange Frame WidthChange Frame WidthChange Frame LeftChange Frame LeftChange Frame RightChange Frame RightChange Frame TopChange Frame TopChange Frame BottomChange Frame BottomChange Frame ThicknessChange Frame ThicknessChange Frame ColorChange Frame ColorChange Frame Fill ColorChange Frame Fill ColorChange Frame StyleChange Frame StyleZebraZebraInterior ticksInterior ticksExterior ticksExterior ticksInterior and exterior ticksInterior and exterior ticksLine borderLine borderChange Grid UnitChange Grid UnitChange Grid Blend ModeChange Grid Blend ModeChange Grid TypeChange Grid TypeChange Grid CRSChange Grid CRSToggle AnnotationsToggle AnnotationsExpression Based AnnotationExpression Based AnnotationChange Annotation DistanceChange Annotation DistanceChange Annotation FontChange Annotation FontChange Grid Line StyleChange Grid Line StyleChange Grid Marker StyleChange Grid Marker StyleChange Annotation ColorChange Annotation ColorChange Annotation PrecisionChange Annotation PrecisionQgsLayoutMapGridWidgetBaseMap OptionsMap OptionsAppearanceAppearanceGrid typeGrid typeCRSCRSChange...Change...Interval unitsInterval unitsMap unitMap unitMillimeterMillimeterCentimeterCentimeterIntervalIntervalX X Y Y OffsetOffsetCross widthCross width mm mmLine styleLine styleMarker styleMarker styleBlend modeBlend modeFrameFrameFrame styleFrame styleFrame sizeFrame sizeFrame line thicknessFrame line thicknessFrame fill colorsFrame fill colorsLeft sideLeft sideRight sideRight sideTop sideTop sideBottom sideBottom sideNo frameNo frameZebraZebraInterior ticksInterior ticksExterior ticksExterior ticksInterior and exterior ticksInterior and exterior ticksLine borderLine borderRight divisionsRight divisionsLeft divisionsLeft divisionsTop divisionsTop divisionsBottom divisionsBottom divisionsDraw CoordinatesDraw CoordinatesFormatFormat……LeftLeftRightRightTopTopBottomBottomFontFontFont colorFont colorDistance to map frameDistance to map frameCoordinate precisionCoordinate precisionQgsLayoutMapWidgetMap PropertiesMap PropertiesUse project CRSUse project CRSSet layer list from a map themeSet layer list from a map themeControlled by %1Controlled by %1atlasatlasAtlasAtlasReportReportUse one of the predefined scales of the project where the %1 feature best fits.Use one of the predefined scales of the project where the %1 feature best fits.No presets definedNo presets definedChange Map PresetChange Map Preset(none)(none)Change Map CRSChange Map CRSChange Overview StyleChange Overview StyleSet Atlas DrivenSet Atlas DrivenChange Atlas ModeChange Atlas ModeChange Atlas MarginChange Atlas MarginChange Atlas ScalesChange Atlas ScalesChange Map ScaleChange Map ScaleChange Map RotationChange Map RotationChange Map ExtentChange Map ExtentChange Frame DivisionsChange Frame DivisionsChange Annotation DisplayChange Annotation DisplayShow allShow allShow latitude onlyShow latitude onlyShow longitude onlyShow longitude onlyMap Preset ChangedMap Preset ChangedToggle Map ItemToggle Map ItemInside frameInside frameOutside frameOutside frameHorizontalHorizontalVertical ascendingVertical ascendingVertical descendingVertical descendingDisabledDisabledChange Annotation PositionChange Annotation PositionChange Annotation DirectionChange Annotation DirectionAllAllLatitude/Y onlyLatitude/Y onlyLongitude/X onlyLongitude/X onlyGrid %1Grid %1Add Map GridAdd Map GridRemove GridRemove GridMove Grid UpMove Grid UpMove Grid DownMove Grid DownDraw "%1" gridDraw "%1" gridRename GridRename GridToggle Grid DisplayToggle Grid DisplayOverview %1Overview %1Add Map OverviewAdd Map OverviewRemove Map OverviewRemove Map OverviewMove Overview UpMove Overview UpMove Overview DownMove Overview DownDraw "%1" overviewDraw "%1" overviewOverview Display ToggledOverview Display ToggledChange Overview MapChange Overview MapChange Overview Blend ModeChange Overview Blend ModeToggle Overview InvertedToggle Overview InvertedToggle Overview CenteredToggle Overview CenteredQgsLayoutMapWidgetBaseMap OptionsMap OptionsMapMapCRSCRS ° °……Draw map canvas itemsDraw map canvas itemsScaleScaleMap rotationMap rotationLayersLayersFollow map themeFollow map themeLock layersLock layersLock styles for layersLock styles for layersExtentsExtentsX minX minY minY minX maxX maxY maxY maxSet to map canvas extentSet to map canvas extentView extent in map canvasView extent in map canvasMain PropertiesMain PropertiesUpdate PreviewUpdate PreviewControlled by AtlasControlled by AtlasMargin around featureMargin around feature%%Use one of the predefined scales of the project where the atlas feature best fits.Use one of the predefined scales of the project where the atlas feature best fits.Predefined scale (best fit)Predefined scale (best fit)Fixed scaleFixed scaleGridsGridsAdd a new gridAdd a new gridRemove selected gridRemove selected gridMove selected grid upMove selected grid upMove selected grid downMove selected grid downDraw gridDraw gridModify grid...Modify grid...OverviewsOverviewsAdd a new overviewAdd a new overviewRemove selected overviewRemove selected overviewMove selected overview upMove selected overview upMove selected overview downMove selected overview downDraw overviewDraw overviewMap frameMap frameFrame styleFrame styleBlending modeBlending modeInvert overviewInvert overviewCenter on overviewCenter on overviewChange...Change...QgsLayoutModelItemItemQgsLayoutMouseHandlesMove ItemsMove ItemsResize ItemsResize Items%1 items selected%1 items selected1 item selected1 item selecteddx: %1 mm dy: %2 mmdx: %1 mm dy: %2 mmwidth: %1 mm height: %2 mmwidth: %1 mm height: %2 mmQgsLayoutMultiFrameChange Resize ModeChange Resize Mode<Multiframe><Multiframe>QgsLayoutNewItemPropertiesDialogNew Item PropertiesNew Item PropertiesReference PointReference PointPosition and SizePosition and SizeHeightHeightWidthWidthYYXXLock aspect ratio (including while drawing extent onto canvas)Lock aspect ratio (including while drawing extent onto canvas)PagePageQgsLayoutNewPageDialogInsert PagesInsert PagesPage SizePage SizeSizeSizeWidthWidthOrientationOrientationHeightHeightLock aspect ratio (including while drawing extent onto canvas)Lock aspect ratio (including while drawing extent onto canvas)page(s)page(s)InsertInsertBefore PageBefore PageAfter PageAfter PageAt EndAt EndQgsLayoutObjectlist of map layer names separated by | characterslist of map layer names separated by | charactersname of an existing map theme (case-sensitive)name of an existing map theme (case-sensitive)QgsLayoutPageCollectionResize to ContentsResize to ContentsMove ItemMove ItemMove GuidesMove GuidesAdd PageAdd PageRemove PageRemove PageRemove PagesRemove PagesQgsLayoutPagePropertiesWidgetNew Item PropertiesNew Item PropertiesBackgroundBackgroundPage SizePage SizeWidthWidthLock aspect ratio (including while drawing extent onto canvas)Lock aspect ratio (including while drawing extent onto canvas)……HeightHeightSizeSizeOrientationOrientationIf checked, this page will not be included when exporting the layoutIf checked, this page will not be included when exporting the layoutExclude page from exportsExclude page from exportsPortraitPortraitLandscapeLandscapeCustomCustomChange Page SizeChange Page SizeChange Page BackgroundChange Page BackgroundInclude Page in ExportsInclude Page in ExportsExclude Page from ExportsExclude Page from ExportsQgsLayoutPictureWidgetPicture PropertiesPicture PropertiesSelect Fill ColorSelect Fill ColorSelect Stroke ColorSelect Stroke ColorGrid northGrid northTrue northTrue northChange PictureChange PictureChange Picture RotationChange Picture RotationSelect SVG or Image FileSelect SVG or Image FileSelect New Preview DirectorySelect New Preview DirectoryChange Resize ModeChange Resize ModeChange PlacementChange PlacementToggle Rotation SyncToggle Rotation SyncChange Rotation MapChange Rotation MapAdding Icons…Adding Icons…AbortAbortCreating icon for file %1Creating icon for file %1Change Picture Fill ColorChange Picture Fill ColorChange Picture Stroke ColorChange Picture Stroke ColorChange Picture Stroke WidthChange Picture Stroke WidthChange Picture North OffsetChange Picture North OffsetChange Picture North ModeChange Picture North ModeQgsLayoutPictureWidgetBasePicture OptionsPicture OptionsPicturePictureMain PropertiesMain PropertiesImage sourceImage source……Resize modeResize modeZoomZoomStretchStretchClipClipZoom and resize frameZoom and resize frameResize frame to image sizeResize frame to image sizePlacementPlacementTop leftTop leftTop centerTop centerTop rightTop rightMiddle leftMiddle leftMiddleMiddleMiddle rightMiddle rightBottom leftBottom leftBottom centerBottom centerBottom rightBottom rightSearch DirectoriesSearch DirectoriesImage RotationImage RotationLoading previews...Loading previews...Image search pathsImage search pathsRemoveRemoveAdd...Add...SVG ParametersSVG Parameters mm mmStroke colorStroke colorStroke widthStroke widthFill colorFill colorNorth alignmentNorth alignmentSync with mapSync with map ° °OffsetOffsetQgsLayoutPolygonWidgetPolygon PropertiesPolygon PropertiesChange Shape StyleChange Shape StyleQgsLayoutPolygonWidgetBaseFormFormPolygonPolygonMain PropertiesMain PropertiesChange...Change...QgsLayoutPolylineWidgetPolyline PropertiesPolyline PropertiesArrow PropertiesArrow PropertiesSelect Arrow Head Stroke ColorSelect Arrow Head Stroke ColorSelect Arrow Head Fill ColorSelect Arrow Head Fill ColorTransparent StrokeTransparent StrokeTransparent FillTransparent FillChange Shape StyleChange Shape StyleChange Arrow HeadChange Arrow HeadChange Arrow WidthChange Arrow WidthChange Arrow Fill ColorChange Arrow Fill ColorChange Arrow Stroke ColorChange Arrow Stroke ColorSet Arrow MarkerSet Arrow MarkerSet Line MarkerSet Line MarkerSet SVG MarkerSet SVG MarkerChange Start Marker FileChange Start Marker FileChange End Marker FileChange End Marker FileStart marker svg fileStart marker svg fileEnd marker svg fileEnd marker svg fileQgsLayoutPolylineWidgetBaseFormFormPolylinePolylineMain PropertiesMain PropertiesLine Style...Line Style...Line MarkersLine MarkersArrow stroke colorArrow stroke color mm mmArrow head widthArrow head widthStart markerStart marker……NoneNoneArrowArrowSVGSVGArrow stroke widthArrow stroke widthEnd markerEnd markerArrow fill colorArrow fill colorSVG pathSVG pathQgsLayoutPropertiesWidgetLayout PropertiesLayout PropertiesResize to ContentsResize to ContentsSet Reference MapSet Reference MapSet Default DPISet Default DPIQgsLayoutQptDropHandlerCould not read template file.Could not read template file.Load from TemplateLoad from TemplateQgsLayoutScaleBarWidgetScalebar PropertiesScalebar PropertiesSingle BoxSingle BoxDouble BoxDouble BoxLine Ticks MiddleLine Ticks MiddleLine Ticks DownLine Ticks DownLine Ticks UpLine Ticks UpNumericNumericLeftLeftMiddleMiddleRightRightMap unitsMap unitsMetersMetersKilometersKilometersFeetFeetYardsYardsMilesMilesNautical MilesNautical MilesCentimetersCentimetersMillimetersMillimetersSelect Fill ColorSelect Fill ColorTransparent FillTransparent FillSelect Alternate Fill ColorSelect Alternate Fill ColorTransparent LineTransparent LineScalebar FontScalebar FontSelect Line ColorSelect Line ColorSet Scalebar Line WidthSet Scalebar Line WidthSet Scalebar Segment SizeSet Scalebar Segment SizeSet Scalebar SegmentsSet Scalebar SegmentsSet Scalebar HeightSet Scalebar HeightSet Scalebar FontSet Scalebar FontSet Scalebar Fill ColorSet Scalebar Fill ColorSet Scalebar Stroke ColorSet Scalebar Stroke ColorSet Scalebar Unit TextSet Scalebar Unit TextSet Scalebar Map Units per SegmentSet Scalebar Map Units per SegmentSet Scalebar StyleSet Scalebar StyleSet Scalebar Label SpaceSet Scalebar Label SpaceSet Scalebar Box SpaceSet Scalebar Box SpaceSet Scalebar AlignmentSet Scalebar AlignmentSet Scalebar UnitsSet Scalebar UnitsSet Scalebar Join StyleSet Scalebar Join StyleSet Scalebar Cap StyleSet Scalebar Cap StyleSet Scalebar Size ModeSet Scalebar Size ModeSet Scalebar MapSet Scalebar MapQgsLayoutScaleBarWidgetBaseScalebar OptionsScalebar OptionsScalebarScalebarSt&yleSt&yle&Map&MapUnitsUnitsScalebar unitsScalebar units&Label for units&Label for unitsSpecifies how many scalebar units per labeled unit. For example, if your scalebar units are set to "meters", a multiplier of 1000 will result in the scalebar labels in kilometers.Specifies how many scalebar units per labeled unit. For example, if your scalebar units are set to "meters", a multiplier of 1000 will result in the scalebar labels in kilometers.Text used for labeling the scalebar units, e.g., "m" or "km". This should be matched to reflect the multiplier above. Text used for labeling the scalebar units, e.g., "m" or "km". This should be matched to reflect the multiplier above. Specifies the underlying units used for scalebar calculations, e.g., "meters" or "feet"Specifies the underlying units used for scalebar calculations, e.g., "meters" or "feet"Label unit multiplierLabel unit multiplierSegmentsSegmentsNumber of scalebar units per scalebar segmentNumber of scalebar units per scalebar segment units unitsHeightHeightright right left left Fi&xed widthFi&xed widthFit segment widthFit segment width mm mmDisplayDisplayBox marginBox marginAlignmentAlignmentLabels marginLabels marginLine widthLine widthCap styleCap styleJoin styleJoin style……Secondary fill colorSecondary fill colorFill colorFill colorMain PropertiesMain PropertiesFonts and ColorsFonts and ColorsLine colorLine colorFontFontQgsLayoutShapeWidgetShape PropertiesShape PropertiesRectangleRectangleEllipseEllipseTriangleTriangleChange Shape StyleChange Shape StyleChange Shape RadiusChange Shape RadiusChange Shape TypeChange Shape TypeQgsLayoutShapeWidgetBaseFormFormShapeShapeMain PropertiesMain PropertiesCorner radiusCorner radiusStyleStyleChange...Change...QgsLayoutTableNo matching recordsNo matching recordsQgsLayoutTableBackgroundColorsDialogChange Table BackgroundChange Table BackgroundSelect Background ColorSelect Background ColorNo BackgroundNo BackgroundQgsLayoutTableBackgroundDialogTable Background ColorsTable Background ColorsFirst rowFirst rowHeader rowHeader rowEven columnsEven columnsFirst columnFirst columnEven rowsEven rowsOdd columnsOdd columnsLast rowLast rowLast columnLast columnDefault cell backgroundDefault cell backgroundOdd rowsOdd rows<html><head/><body><p>Check options to enable shading for matching cells. Options lower in this list will take precedence over higher options. For example, if both "<span style=" font-style:italic;">First row</span>" and "<span style=" font-style:italic;">Odd rows</span>" are checked, the cells in the first row will be shaded using the color specified for "<span style=" font-style:italic;">First row</span>".</p></body></html><html><head/><body><p>Check options to enable shading for matching cells. Options lower in this list will take precedence over higher options. For example, if both "<span style=" font-style:italic;">First row</span>" and "<span style=" font-style:italic;">Odd rows</span>" are checked, the cells in the first row will be shaded using the color specified for "<span style=" font-style:italic;">First row</span>".</p></body></html>QgsLayoutTableSortColumnsProxyModelDescendingDescendingAscendingAscendingAttributeAttributeSort OrderSort OrderQgsLayoutViewCut ItemsCut ItemsPaste ItemsPaste ItemsLock ItemsLock ItemsUnlock ItemsUnlock ItemsDelete ItemsDelete ItemsMove ItemMove ItemQgsLayoutViewEllipticalRubberBandwidth: %1 %3 height: %2 %3width: %1 %3 height: %2 %3QgsLayoutViewRectangularRubberBandwidth: %1 %3 height: %2 %3width: %1 %3 height: %2 %3QgsLayoutViewToolAddItemAdd itemAdd itemCreate %1Create %1Create ItemCreate ItemQgsLayoutViewToolAddNodeItemAdd itemAdd itemQgsLayoutViewToolEditNodesSelectSelectRemove Item NodeRemove Item NodeMove Item NodeMove Item NodeAdd Item NodeAdd Item NodeQgsLayoutViewToolMoveItemContentSelectSelectMove Item ContentMove Item ContentZoom Item ContentZoom Item ContentQgsLayoutViewToolPanPanPanQgsLayoutViewToolSelectSelectSelectQgsLayoutViewToolTemporaryKeyPanPanPanQgsLayoutViewToolTemporaryMousePanPanPanQgsLayoutViewToolZoomPanPanQgsLayoutViewTriangleRubberBandwidth: %1 %3 height: %2 %3width: %1 %3 height: %2 %3QgsLayoutWidgetBaseCompositionCompositionGeneral SettingsGeneral SettingsReference mapReference mapSpecifies the master map for this composition, which is used to georeference composer exports and for scale calculation for item styles.Specifies the master map for this composition, which is used to georeference composer exports and for scale calculation for item styles.Guides and GridGuides and Gridx: x: y: y: px pxGrid spacingGrid spacingGrid offsetGrid offsetSnap toleranceSnap toleranceExport SettingsExport SettingsResize Layout to ContentResize Layout to ContentIf checked, a separate world file which georeferences exported images will be createdIf checked, a separate world file which georeferences exported images will be createdSave world fileSave world fileExport resolutionExport resolution dpi dpiIf checked, exports from this layout will be rasterized.If checked, exports from this layout will be rasterized.Print as rasterPrint as rasterIf checked, the layout will always be kept as vector objects when exported to a compatible format, even if the appearance of the resultant file does not match the layouts settings. If unchecked, some elements in the layout may be rasterized in order to keep their appearance intact.If checked, the layout will always be kept as vector objects when exported to a compatible format, even if the appearance of the resultant file does not match the layouts settings. If unchecked, some elements in the layout may be rasterized in order to keep their appearance intact.Always export as vectorsAlways export as vectorsMargin unitsMargin unitsTop marginTop marginLeftLeftRightRightBottomBottomResize layoutResize layoutVariablesVariablesQgsLegendFilterButtonEdit Filter Expression…Edit Filter Expression…Clear Filter ExpressionClear Filter ExpressionEdit filter expressionEdit filter expressionEdit filter expression (current: %1)Edit filter expression (current: %1)QgsLimitedRandomColorRampDialogRandom Color RampRandom Color RampQgsLimitedRandomColorRampWidgetBaseRandom Color RampRandom Color RampHueHuetotoSaturationSaturationValueValueClassesClassesPreviewPreviewQgsLocatorFiltersModelFilterFilterPrefixPrefixEnabledEnabledDefaultDefaultConfigurationConfigurationQgsLocatorWidgetType to locate (⌘K)Type to locate (⌘K)Type to locate (Ctrl+K)Type to locate (Ctrl+K)<type here><type here>Configure…Configure…QgsManageConnectionsDialogSelect allSelect allClear selectionClear selectionSelect connections to importSelect connections to importImportImportExportExportExport/Import ErrorExport/Import ErrorSave ConnectionsSave ConnectionsSaving ConnectionsSaving ConnectionsLoading ConnectionsLoading ConnectionsThe file is not a WMS connections exchange file.The file is not a WMS connections exchange file.The file is not a WFS connections exchange file.The file is not a WFS connections exchange file.The file is not a WCS connections exchange file.The file is not a WCS connections exchange file.The file is not a PostGIS connections exchange file.The file is not a PostGIS connections exchange file.The file is not a MSSQL connections exchange file.The file is not a MSSQL connections exchange file.The file is not a DB2 connections exchange file.The file is not a DB2 connections exchange file.The file is not a GeoNode connections exchange file.The file is not a GeoNode connections exchange file.The file is not a XYZ Tiles connections exchange file.The file is not a XYZ Tiles connections exchange file.The file is not a %1 connections exchange file.The file is not a %1 connections exchange file.You should select at least one connection from list.You should select at least one connection from list.XML files (*.xml *.XML)XML files (*.xml *.XML)Cannot write file %1:
%2.Cannot write file %1:
%2.Cannot read file %1:
%2.Cannot read file %1:
%2.Parse error at line %1, column %2:
%3Parse error at line %1, column %2:
%3The file is not an Oracle connections exchange file.The file is not an Oracle connections exchange file.Connection with name '%1' already exists. Overwrite?Connection with name '%1' already exists. Overwrite?QgsManageConnectionsDialogBaseManage ConnectionsManage ConnectionsSelect connections to exportSelect connections to exportQgsMapCanvasMap CanvasMap CanvasRenderingRenderingCanvas refresh: %1 msCanvas refresh: %1 msCannot zoom to selected feature(s)Cannot zoom to selected feature(s)No extent could be determined.No extent could be determined.Pan to feature id failedPan to feature id failedFeature does not have a geometryFeature does not have a geometryFeature geometry is emptyFeature geometry is emptyZoom to feature id failedZoom to feature id failedFeature not foundFeature not foundCannot pan to selected feature(s)Cannot pan to selected feature(s)QgsMapCanvasDockWidgetSet View ThemeSet View ThemeView SettingsView SettingsChange Map CRS (%1)…Change Map CRS (%1)…No projectionNo projection(default)(default)QgsMapCanvasDockWidgetBaseMap CanvasMap CanvasSet Map CRS…Set Map CRS…Set Map CRSSet Map CRSRename View…Rename View…Rename ViewRename ViewZoom to &SelectionZoom to &SelectionZoom to &LayerZoom to &LayerZoom &FullZoom &FullShow AnnotationsShow AnnotationsShow Cursor PositionShow Cursor PositionShow Main Canvas ExtentShow Main Canvas ExtentShow LabelsShow LabelsQgsMapCanvasSnappingUtilsIndexing data…Indexing data…QgsMapCanvasTracerDisabled - there are too many features displayed. Try zooming in or disable some layers.Disabled - there are too many features displayed. Try zooming in or disable some layers.Tracing may not work correctly. Please check topology of the input layers.Tracing may not work correctly. Please check topology of the input layers.TracingTracingQgsMapCoordsDialogFrom map canvasFrom map canvasQgsMapCoordsDialogBaseEnter Map CoordinatesEnter Map Coordinates<html><head/><body><p>Enter X and Y coordinates (DMS (<span style=" font-style:italic;">dd mm ss.ss</span>), DD (<span style=" font-style:italic;">dd.dd</span>) or projected coordinates (<span style=" font-style:italic;">mmmm.mm</span>)) which correspond with the selected point on the image. Alternatively, click the button with icon of a pencil and then click a corresponding point on map canvas of QGIS to fill in coordinates of that point.</p></body></html><html><head/><body><p>Enter X and Y coordinates (DMS (<span style=" font-style:italic;">dd mm ss.ss</span>), DD (<span style=" font-style:italic;">dd.dd</span>) or projected coordinates (<span style=" font-style:italic;">mmmm.mm</span>)) which correspond with the selected point on the image. Alternatively, click the button with icon of a pencil and then click a corresponding point on map canvas of QGIS to fill in coordinates of that point.</p></body></html>Y / NorthY / NorthX / EastX / EastQgsMapLayerSpecify CRS for layer %1Specify CRS for layer %1%1 at line %2 column %3%1 at line %2 column %3Loading style file %1 failed because:
%2Loading style file %1 failed because:
%2Cannot apply style with symbology to layer with a different geometry typeCannot apply style with symbology to layer with a different geometry typeCould not save symbology because:
%1Could not save symbology because:
%1The directory containing your dataset needs to be writable!The directory containing your dataset needs to be writable!LayerLayerStyle not found in databaseStyle not found in databaseMetadata not found in databaseMetadata not found in databaseLoading metadata file %1 failed because:
%2Loading metadata file %1 failed because:
%2Created default metadata file as %1Created default metadata file as %1Created default style file as %1Created default style file as %1ERROR: Failed to created default metadata file as %1. Check file permissions and retry.ERROR: Failed to created default metadata file as %1. Check file permissions and retry.ERROR: Failed to created default style file as %1. Check file permissions and retry.ERROR: Failed to created default style file as %1. Check file permissions and retry.User database could not be opened.User database could not be opened.The metadata table could not be created.The metadata table could not be created.The style table could not be created.The style table could not be created.The metadata %1 was saved to databaseThe metadata %1 was saved to databaseThe style %1 was saved to databaseThe style %1 was saved to databaseThe metadata %1 was updated in the database.The metadata %1 was updated in the database.The style %1 was updated in the database.The style %1 was updated in the database.The metadata %1 could not be updated in the database.The metadata %1 could not be updated in the database.The style %1 could not be updated in the database.The style %1 could not be updated in the database.The metadata %1 could not be inserted into database.The metadata %1 could not be inserted into database.The style %1 could not be inserted into database.The style %1 could not be inserted into database.ERROR: Failed to created SLD style file as %1. Check file permissions and retry.ERROR: Failed to created SLD style file as %1. Check file permissions and retry.Unable to open file %1Unable to open file %1Root <qgis> element could not be foundRoot <qgis> element could not be foundQgsMapLayerComboBoxPluginA combo box to list the layersA combo box to list the layersA combo box to list the layers registered in QGIS. Layers might be filtered according to their type.A combo box to list the layers registered in QGIS. Layers might be filtered according to their type.QgsMapLayerModel%1 [%2]%1 [%2]%1 (%2 - %3)%1 (%2 - %3)%1 (%2) %1 (%2) QgsMapLayerStyleCategoriesModelLayer ConfigurationLayer ConfigurationIdentifiable, removable, searchable, display expression, read-onlyIdentifiable, removable, searchable, display expression, read-onlySymbologySymbology3D Symbology3D SymbologyLabelsLabelsFieldsFieldsAliases, widgets, WMS/WFS, expressions, constraints, virtual fieldsAliases, widgets, WMS/WFS, expressions, constraints, virtual fieldsFormsFormsActionsActionsMap TipsMap TipsDiagramsDiagramsAttribute Table SettingsAttribute Table SettingsChoice and order of columns, conditional stylingChoice and order of columns, conditional stylingRenderingRenderingScale visibility, simplify method, opacityScale visibility, simplify method, opacityCustom PropertiesCustom PropertiesGeometry OptionsGeometry OptionsGeometry constraints and validity checksGeometry constraints and validity checksAll Style CategoriesAll Style CategoriesQgsMapLayerStyleGuiUtilsRemove CurrentRemove CurrentAdd…Add…Rename Current…Rename Current…New styleNew styleStyle name:Style name:Rename styleRename styleQgsMapLayerStyleManagerdefaultdefaultQgsMapLayerStyleManagerWidgetAddAddRemove CurrentRemove CurrentLoad StyleLoad StyleSave as DefaultSave as DefaultRestore DefaultRestore DefaultNew styleNew styleStyle name:Style name:Save StyleSave StyleSave default style to: Save default style to: CancelCancelLocal databaseLocal databaseDatasource databaseDatasource databaseDefault StyleDefault StyleLoad default style from: Load default style from: Loaded from ProviderLoaded from ProviderNo default style was found for this layerNo default style was found for this layerLoad layer properties from style fileLoad layer properties from style fileQGIS Layer Style FileQGIS Layer Style FileSLD FileSLD FileQgsMapRendererJobThere was a problem transforming the layer's extent. Layer skipped.There was a problem transforming the layer's extent. Layer skipped.Insufficient memory for image %1x%2Insufficient memory for image %1x%2Insufficient memory for label image %1x%2Insufficient memory for label image %1x%2LabelingLabeling%1 ms: %2%1 ms: %2RenderingRenderingQgsMapRendererTaskSaving as imageSaving as imageRendering to painterRendering to painterQgsMapSaveDialogSave Map as ImageSave Map as ImageAdvanced effects such as blend modes or vector layer transparency cannot be exported as vectors.
Rasterizing the map is recommended when such effects are used.Advanced effects such as blend modes or vector layer transparency cannot be exported as vectors.
Rasterizing the map is recommended when such effects are used.Rasterize mapRasterize mapSave world fileSave world fileDraw annotationsDraw annotationsDraw active decorationsDraw active decorationsOutput heightOutput heightOutput widthOutput width px pxLock aspect ratio (including while drawing extent onto canvas)Lock aspect ratio (including while drawing extent onto canvas)ResolutionResolution dpi dpiScaleScaleExtentExtentDraw active decorations: %1Draw active decorations: %1nonenoneThe following layer(s) use advanced effects:
%1
Rasterizing map is recommended for proper rendering.The following layer(s) use advanced effects:
%1
Rasterizing map is recommended for proper rendering.Save Map as PDFSave Map as PDFCopy to ClipboardCopy to ClipboardSave as imageSave as imageCould not allocate required memory for imageCould not allocate required memory for imageSuccessfully copied map to clipboardSuccessfully copied map to clipboardSave as PDFSave as PDFCould not copy the map to clipboardCould not copy the map to clipboardChoose a file name to save the map image asChoose a file name to save the map image asSuccessfully saved map to <a href="%1">%2</a>Successfully saved map to <a href="%1">%2</a>Could not save the map to fileCould not save the map to filePDF FormatPDF FormatSave Map AsSave Map AsCould not save the map to PDFCould not save the map to PDFQgsMapSettingsActionSynchronize View Center with Main MapSynchronize View Center with Main MapSynchronize View to SelectionSynchronize View to SelectionScaleScale ° °Current clockwise map rotation in degreesCurrent clockwise map rotation in degreesRotationRotationMagnifier levelMagnifier levelMagnificationMagnificationSynchronize scaleSynchronize scale××Multiplication factor for main canvas scale to view scaleMultiplication factor for main canvas scale to view scaleScale FactorScale FactorQgsMapThemesReplace ThemeReplace ThemeAdd Theme…Add Theme…Remove Current ThemeRemove Current ThemethemethemeThemeThemeMap ThemesMap ThemesName of the new themeName of the new themeA theme with this name already exists.A theme with this name already exists.Are you sure you want to replace the existing theme “%1”?Are you sure you want to replace the existing theme “%1”?Remove ThemeRemove ThemeAre you sure you want to remove the existing theme “%1”?Are you sure you want to remove the existing theme “%1”?QgsMapToolAddFeatureadd featureadd featureAdd featureAdd featureQgsMapToolAddPartNo feature selected. Please select a feature with the selection tool or in the attribute tableNo feature selected. Please select a feature with the selection tool or in the attribute tableSeveral features are selected. Please select only one feature to which an part should be added.Several features are selected. Please select only one feature to which an part should be added.Part addedPart addedCould not add part. %1Could not add part. %1Add partAdd partCoordinate transform error. Cannot transform the point to the layers coordinate systemCoordinate transform error. Cannot transform the point to the layers coordinate systemAdd part: Feature geom is single part and you've added more than oneAdd part: Feature geom is single part and you've added more than oneSelected feature is not multi part.Selected feature is not multi part.New part's geometry is not valid.New part's geometry is not valid.New polygon ring not disjoint with existing polygons.New polygon ring not disjoint with existing polygons.Several features are selected. Please select only one feature to which an island should be added.Several features are selected. Please select only one feature to which an island should be added.Selected geometry could not be foundSelected geometry could not be foundQgsMapToolAddRegularPolygonNumber of sides: Number of sides: QgsMapToolAddRingAdd ringAdd ringCannot transform the point to the layers coordinate system.Cannot transform the point to the layers coordinate system.Ring addedRing addeda problem with geometry type occurreda problem with geometry type occurredthe inserted ring is not closedthe inserted ring is not closedthe inserted ring is not a valid geometrythe inserted ring is not a valid geometrythe inserted ring crosses existing ringsthe inserted ring crosses existing ringsthe inserted ring is not contained in a featurethe inserted ring is not contained in a featurean unknown error occurredan unknown error occurredCould not add ring since %1.Could not add ring since %1.QgsMapToolChangeLabelPropertiesChanged properties for labelChanged properties for labelQgsMapToolCircle2TangentsPointErrorErrorSegments are parallelsSegments are parallelsRadius of the circle: Radius of the circle: QgsMapToolCircle3TangentsErrorErrorAt least two segments are parallelsAt least two segments are parallelsQgsMapToolCircularStringRadiusRadius: Radius: QgsMapToolDeletePartDelete partDelete partPart of multipart feature deletedPart of multipart feature deletedCouldn't remove the selected part.Couldn't remove the selected part.QgsMapToolDeleteRingDelete ringDelete ringDelete ring can only be used in a polygon layer.Delete ring can only be used in a polygon layer.Ring deletedRing deletedQgsMapToolDigitizeFeatureDigitize featureDigitize featureThe data provider for this layer does not support the addition of features.The data provider for this layer does not support the addition of features.Wrong editing tool, cannot apply the 'capture point' tool on this vector layerWrong editing tool, cannot apply the 'capture point' tool on this vector layerCannot transform the point to the layers coordinate systemCannot transform the point to the layers coordinate systemWrong editing tool, cannot apply the 'capture line' tool on this vector layerWrong editing tool, cannot apply the 'capture line' tool on this vector layerWrong editing tool, cannot apply the 'capture polygon' tool on this vector layerWrong editing tool, cannot apply the 'capture polygon' tool on this vector layerThe feature cannot be added because it's geometry collapsed due to intersection avoidanceThe feature cannot be added because it's geometry collapsed due to intersection avoidanceQgsMapToolEditNo active vector layerNo active vector layerLayer not editableLayer not editableQgsMapToolFeatureActionTo run an action, you must choose an active vector layer.To run an action, you must choose an active vector layer.The active vector layer has no defined actionsThe active vector layer has no defined actionsNo features at this position found.No features at this position found.All FeaturesAll FeaturesQgsMapToolFillRingCannot transform the point to the layers coordinate systemCannot transform the point to the layers coordinate systemRing added and filledRing added and filleda problem with geometry type occurreda problem with geometry type occurredthe inserted Ring is not closedthe inserted Ring is not closedthe inserted Ring is not a valid geometrythe inserted Ring is not a valid geometrythe inserted Ring crosses existing ringsthe inserted Ring crosses existing ringsthe inserted Ring is not contained in a featurethe inserted Ring is not contained in a featurean unknown error occurredan unknown error occurredcould not add ring since %1.could not add ring since %1.Ring filledRing filledNo ring found to fill.No ring found to fill.QgsMapToolIdentifyNo active layer. To identify features, you must choose an active layer.No active layer. To identify features, you must choose an active layer.Identifying on %1…Identifying on %1…Identifying done.Identifying done.(clicked coordinate X)(clicked coordinate X)(clicked coordinate Y)(clicked coordinate Y)(clicked coordinate Z)(clicked coordinate Z)new featurenew featureFeature IDFeature IDClosest vertex numberClosest vertex numberClosest vertex XClosest vertex XClosest vertex YClosest vertex YClosest vertex ZClosest vertex ZClosest vertex MClosest vertex MClosest XClosest XClosest YClosest YInterpolated ZInterpolated ZInterpolated MInterpolated MPartsPartsPart numberPart numberLength (Ellipsoidal, %1)Length (Ellipsoidal, %1)Length (Cartesian)Length (Cartesian)Area (Ellipsoidal, %1)Area (Ellipsoidal, %1)Area (Cartesian)Area (Cartesian)Perimeter (Ellipsoidal, %1)Perimeter (Ellipsoidal, %1)Perimeter (Cartesian)Perimeter (Cartesian)XXYYZZMMVerticesVerticesfirstXattributes get sorted; translation for lastX should be lexically larger than this onefirstXfirstYfirstYlastXattributes get sorted; translation for firstX should be lexically smaller than this onelastXlastYlastYno datano dataErrorErrorIdentify errorIdentify errorQgsMapToolIdentifyActionIdentifyIdentifyShow Attribute TableShow Attribute TableIdentifying featuresIdentifying featuresNo features at this position found.No features at this position found.QgsMapToolIdentifyFeatureIdentify featureIdentify featureQgsMapToolMeasureAngleMeasure angleMeasure angleQgsMapToolMoveFeatureMove featureMove featureMove featuresMove featuresSome of the selected features are outside of the current map view. Would you still like to continue?Some of the selected features are outside of the current map view. Would you still like to continue?Feature movedFeature movedFeature copied and movedFeature copied and movedQgsMapToolMoveLabelMove labelMove labelMoved labelMoved labelQgsMapToolOffsetCurveCould not find a nearby feature in any vector layer.Could not find a nearby feature in any vector layer.Generated geometry is not valid.Generated geometry is not valid.Offset curveOffset curveCreating offset geometry failed: %1Creating offset geometry failed: %1QgsMapToolOffsetPointSymbolThe selected point does not have an offset attribute set.The selected point does not have an offset attribute set.Offset symbolOffset symbolQgsMapToolPanPanPanQgsMapToolPinLabelsPin labelsPin labelsPinned labelPinned labelUnpinned labelUnpinned labelPinned diagramPinned diagramUnpinned diagramUnpinned diagramQgsMapToolPointSymbolNo point feature was detected at the clicked position. Please click closer to the feature or enhance the search tolerance under Settings->Options->Digitizing->Search radius for vertex editsNo point feature was detected at the clicked position. Please click closer to the feature or enhance the search tolerance under Settings->Options->Digitizing->Search radius for vertex editsQgsMapToolReshapeCannot transform the point to the layers coordinate systemCannot transform the point to the layers coordinate systemReshapeReshapeAn error was reported during intersection removalAn error was reported during intersection removalThe feature cannot be reshaped because the resulting geometry is emptyThe feature cannot be reshaped because the resulting geometry is emptyQgsMapToolReverseLineReverse line geometryReverse line geometryReverse lineReverse lineLine reversed.Line reversed.Couldn't reverse the selected part.Couldn't reverse the selected part.QgsMapToolRotateFeatureCould not find a nearby feature in the current layer.Could not find a nearby feature in the current layer.Features RotatedFeatures RotatedQgsMapToolRotateLabelRotated labelRotated labelQgsMapToolRotatePointSymbolsThe selected point does not have a rotation attribute set.The selected point does not have a rotation attribute set.Rotate symbolRotate symbolQgsMapToolSelectSelect featuresSelect featuresQgsMapToolSelectionHandlerSelection radius:Selection radius:QgsMapToolShowHideLabelsShow/hide labelsShow/hide labelsHid labelsHid labelsShowed labelsShowed labelsCRS Exception: selection extends beyond layer's coordinate system.CRS Exception: selection extends beyond layer's coordinate system.QgsMapToolSimplifyGeometry simplifiedGeometry simplifiedCould not find a nearby feature in the current layer.Could not find a nearby feature in the current layer.%1 feature(s): %2 to %3 vertices (%4%)%1 feature(s): %2 to %3 vertices (%4%)Simplification failed!Simplification failed!QgsMapToolSplitFeaturesCoordinate transform errorCoordinate transform errorCannot transform the point to the layers coordinate systemCannot transform the point to the layers coordinate systemFeatures splitFeatures splitNo features were splitNo features were splitIf there are selected features, the split tool only applies to those. If you would like to split all features under the split line, clear the selection.If there are selected features, the split tool only applies to those. If you would like to split all features under the split line, clear the selection.No feature split doneNo feature split doneAn error occurred during splitting.An error occurred during splitting.Cut edges detected. Make sure the line splits features into multiple parts.Cut edges detected. Make sure the line splits features into multiple parts.Split featuresSplit featuresThe geometry is invalid. Please repair before trying to split it.The geometry is invalid. Please repair before trying to split it.QgsMapToolSplitPartsCoordinate transform errorCoordinate transform errorCannot transform the point to the layers coordinate systemCannot transform the point to the layers coordinate systemParts splitParts splitNo parts were splitNo parts were splitIf there are selected parts, the split tool only applies to those. If you would like to split all parts under the split line, clear the selection.If there are selected parts, the split tool only applies to those. If you would like to split all parts under the split line, clear the selection.No part split doneNo part split doneAn error occurred during splitting.An error occurred during splitting.Cut edges detected. Make sure the line splits parts into multiple parts.Cut edges detected. Make sure the line splits parts into multiple parts.Split partsSplit partsThe geometry is invalid. Please repair before trying to split it.The geometry is invalid. Please repair before trying to split it.Split errorSplit errorQgsMapToolZoomZoomZoomQgsMapUnitScaleDialogAdjust Scaling RangeAdjust Scaling RangeQgsMapUnitScaleWidgetBaseAdjust Scaling RangeAdjust Scaling RangeScale only within the following map unit scale rangeScale only within the following map unit scale rangeMinimum scaleMinimum scaleMaximum scaleMaximum scaleScale RangeScale RangeSize RangeSize RangeMinimum sizeMinimum sizeMaximum sizeMaximum size mm mmScale only within the following size rangeScale only within the following size rangeQgsMasterPasswordResetDialogReset Master PasswordReset Master PasswordEnter CURRENT master authentication passwordEnter CURRENT master authentication passwordRequiredRequiredEnter NEW master authentication passwordEnter NEW master authentication passwordKeep backup of current databaseKeep backup of current databaseYour authentication database will be duplicated
and re-encrypted using new passwordYour authentication database will be duplicated
and re-encrypted using new passwordQgsMdalSourceSelectOpen MDAL Supported Mesh Dataset(s)Open MDAL Supported Mesh Dataset(s)All Files (*);;GRIB File (*.grb *.grb2 *.bin *.grib *.grib1 *.grib2);;NetCDF File (*.nc);;2DM Mesh File (*.2dm);;3Di Results (results_3di.nc)All Files (*);;GRIB File (*.grb *.grb2 *.bin *.grib *.grib1 *.grib2);;NetCDF File (*.nc);;2DM Mesh File (*.2dm);;3Di Results (results_3di.nc)Add mesh layerAdd mesh layerNo layers selected.No layers selected.QgsMdalSourceSelectBaseAdd Mesh Layer(s)Add Mesh Layer(s)SourceSourceMesh datasetMesh datasetQgsMeasureBaseMeasureMeasureTotalTotalSegmentsSegmentsInfoInfoQgsMeasureDialog&New&New&Configuration&ConfigurationThe calculations are based on:The calculations are based on:No map projection set, so area is calculated using Cartesian calculations.No map projection set, so area is calculated using Cartesian calculations.Units are unknown.Units are unknown.Both project CRS (%1) and measured area are in degrees, so area is calculated using Cartesian calculations in square degrees.Both project CRS (%1) and measured area are in degrees, so area is calculated using Cartesian calculations in square degrees.Project ellipsoidal calculation is selected.Project ellipsoidal calculation is selected.Project ellipsoidal calculation is not selected.Project ellipsoidal calculation is not selected.MeasureMeasureNo map projection set, so distance is calculated using Cartesian calculations.No map projection set, so distance is calculated using Cartesian calculations.Both project CRS (%1) and measured length are in degrees, so distance is calculated using Cartesian calculations in degrees.Both project CRS (%1) and measured length are in degrees, so distance is calculated using Cartesian calculations in degrees.Distance is calculated in %1, based on project CRS (%2).Distance is calculated in %1, based on project CRS (%2).The value is converted from %1 to %2.The value is converted from %1 to %2.Area is calculated in %1, based on project CRS (%2).Area is calculated in %1, based on project CRS (%2).The coordinates are transformed to the chosen ellipsoid (%1), and the area is calculated in %2.The coordinates are transformed to the chosen ellipsoid (%1), and the area is calculated in %2.The coordinates are transformed to the chosen ellipsoid (%1), and the distance is calculated in %2.The coordinates are transformed to the chosen ellipsoid (%1), and the distance is calculated in %2.Segments [%1]Segments [%1]SegmentsSegmentsmap unitsmap unitsQgsMeasureToolIncorrect Measure ResultsIncorrect Measure Results<p>This map is defined with a geographic coordinate system (latitude/longitude) but the map extents suggests that it is actually a projected coordinate system (e.g., Mercator). If so, the results from line or area measurements will be incorrect.</p><p>To fix this, explicitly set an appropriate map coordinate system using the <tt>Settings:Project Properties</tt> menu.<p>This map is defined with a geographic coordinate system (latitude/longitude) but the map extents suggests that it is actually a projected coordinate system (e.g., Mercator). If so, the results from line or area measurements will be incorrect.</p><p>To fix this, explicitly set an appropriate map coordinate system using the <tt>Settings:Project Properties</tt> menu.Transform error caught at the MeasureTool: %1Transform error caught at the MeasureTool: %1QgsMemoryProviderWhole number (integer)Whole number (integer)Decimal number (real)Decimal number (real)Text (string)Text (string)DateDateTimeTimeDate & TimeDate & TimeWhole number (smallint - 16bit)Whole number (smallint - 16bit)Whole number (integer - 32bit)Whole number (integer - 32bit)Whole number (integer - 64bit)Whole number (integer - 64bit)Decimal number (numeric)Decimal number (numeric)Decimal number (decimal)Decimal number (decimal)Decimal number (double)Decimal number (double)Text, unlimited length (text)Text, unlimited length (text)Feature has too many attributes (expecting %1, received %2)Feature has too many attributes (expecting %1, received %2)Could not add feature with geometry type %1 to layer of type %2Could not add feature with geometry type %1 to layer of type %2QgsMergeAttributesDialogSkip attributeSkip attributeIdIdMergeMergeFeature %1Feature %1ConcatenationConcatenationManual valueManual valueSkippedSkippedQgsMergeAttributesDialogBaseMerge Feature AttributesMerge Feature AttributesTake attributes from selected featureTake attributes from selected featureRemove feature from selectionRemove feature from selectionResets all fields to "Skip"Resets all fields to "Skip"Skip all fieldsSkip all fieldsQgsMergedBookmarksTableModelIn ProjectIn ProjectQgsMeshDatasetGroupTreeModelGroupsGroupsQgsMeshLayerPropertiesLayer Properties - %1Layer Properties - %1UriUriVertex countVertex countFace countFace countDataset groups countDataset groups countInvalid data providerInvalid data providerNot assignedNot assignedLoad mesh datasetsLoad mesh datasetsDatasets successfully added to the mesh layerDatasets successfully added to the mesh layerCould not read mesh dataset.Could not read mesh dataset.QgsMeshLayerPropertiesBaseRaster Layer PropertiesRaster Layer PropertiesInformationInformationSourceSourceStyleStyleLayer nameLayer namedisplayed asdisplayed asSet source coordinate reference systemSet source coordinate reference systemUriUriAssign Extra Dataset to MeshAssign Extra Dataset to MeshQgsMeshMemoryDataProviderInvalid mesh definition, does not contain 2 sectionsInvalid mesh definition, does not contain 2 sectionsInvalid mesh definition, vertex definition does not contain x, yInvalid mesh definition, vertex definition does not contain x, yInvalid mesh definition, face must contain at least 3 verticesInvalid mesh definition, face must contain at least 3 verticesInvalid mesh definition, vertex index must be positive valueInvalid mesh definition, vertex index must be positive valueInvalid mesh definition, missing vertex id defined in faceInvalid mesh definition, missing vertex id defined in faceInvalid dataset definition, does not contain 3+ sectionsInvalid dataset definition, does not contain 3+ sectionsInvalid type definition, must be Vertex/Face Vector/Scalar NameInvalid type definition, must be Vertex/Face Vector/Scalar NameUnable to add dataset group to invalid meshUnable to add dataset group to invalid meshInvalid dataset definition, dataset metadata does not contain key: valueInvalid dataset definition, dataset metadata does not contain key: valueInvalid dataset definition, must contain at least 1 line (time)Invalid dataset definition, must contain at least 1 line (time)Invalid dataset definition, dataset scalar values must be xInvalid dataset definition, dataset scalar values must be xInvalid dataset definition, dataset vector values must be x, yInvalid dataset definition, dataset vector values must be x, yDataset defined on vertices has {} values, but mesh {}Dataset defined on vertices has {} values, but mesh {}Dataset defined on faces has {} values, but mesh {}Dataset defined on faces has {} values, but mesh {}QgsMeshRendererActiveDatasetWidgetYesYesIs validIs validInvalid mesh layer selectedInvalid mesh layer selectedScalar datasetScalar datasetVector datasetVector datasetNo mesh dataset selectedNo mesh dataset selectedNoNoTimeTimeData TypeData TypeDefined on verticesDefined on verticesDefined on facesDefined on facesIs vectorIs vectorQgsMeshRendererActiveDatasetWidgetBaseFormFormDataset in Selected Group(s)Dataset in Selected Group(s)>|>|>><<|<|<MetadataMetadataQgsMeshRendererMeshSettingsWidgetBaseFormFormLine Width and ColorLine Width and ColorQgsMeshRendererScalarSettingsWidgetBaseFormFormOpacityOpacityMinMin00MaxMax11LoadLoadQgsMeshRendererVectorSettingsWidgetBaseFormFormLine Width and ColorLine Width and ColorFilter by MagnitudeFilter by MagnitudeMinMin Max MaxDisplay Vectors on User GridDisplay Vectors on User GridX SpacingX SpacingY SpacingY Spacing px pxHead OptionsHead OptionsWidthWidth% of Shaft Length% of Shaft LengthLengthLengthArrow LengthArrow LengthDefined by Min and MaxDefined by Min and MaxScaled to MagnitudeScaled to MagnitudeFixedFixedMinimumMinimumMaximumMaximumScale by a Factor of:Scale by a Factor of:QgsMessageBarRemaining messagesRemaining messagesClose AllClose AllCloseCloseMessagesMessagesShow moreShow more%n moreunread messages%n more%n moreQgsMessageLogViewerQGIS LogQGIS LogGeneralGeneralQgsMessageViewerQGIS MessageQGIS MessageDon't show this message againDon't show this message againQgsMetadataWidgetTypeTypeNameNameFarmingFarmingClimatology Meteorology AtmosphereClimatology Meteorology AtmosphereLocationLocationIntelligence MilitaryIntelligence MilitaryTransportationTransportationStructureStructureBoundariesBoundariesInland WatersInland WatersPlanning CadastrePlanning CadastreGeoscientific InformationGeoscientific InformationElevationElevationHealthHealthBiotaBiotaOceansOceansEnvironmentEnvironmentUtilities CommunicationUtilities CommunicationEconomyEconomySocietySocietyImagery Base Maps Earth CoverImagery Base Maps Earth CoverConstraintConstraintURLURLDescriptionDescriptionFormatFormatMIMEMIMESizeSizedatasetdatasetDatasetDatasetprojectprojectProjectProjectThis page describes the basic attribution of the %1. Please use the tooltips for more information.This page describes the basic attribution of the %1. Please use the tooltips for more information.%1 categories.%1 categories.Contacts related to the %1.Contacts related to the %1.Links describe ancillary resources and information related to this %1.Links describe ancillary resources and information related to this %1.History about the %1.History about the %1.<html><head/><body><p>Keywords are optional, and provide a way to provide additional descriptive information about the %1. Edits made in the categories tab will update the category entry below. For the concept, we suggest to use a standard based vocabulary such as <a href="https://www.eionet.europa.eu/gemet/en/inspire-themes/"><span style=" text-decoration: underline; color:#0000ff;">GEMET.</span></a></p></body></html><html><head/><body><p>Keywords are optional, and provide a way to provide additional descriptive information about the %1. Edits made in the categories tab will update the category entry below. For the concept, we suggest to use a standard based vocabulary such as <a href="https://www.eionet.europa.eu/gemet/en/inspire-themes/"><span style=" text-decoration: underline; color:#0000ff;">GEMET.</span></a></p></body></html>Set from %1Set from %1layerlayerundefined %1undefined %1New LicenceNew LicenceNew RightNew RightCRS: %1 - %2CRS: %1 - %2Same as layer properties and provider.Same as layer properties and provider.Same as layer properties but different than the provider.Same as layer properties but different than the provider.Same as the provider but different than the layer properties.Same as the provider but different than the layer properties.Does not match either layer properties or the provider.Does not match either layer properties or the provider.CRS: Not set.CRS: Not set.postalpostalNew HistoryNew HistoryOk, it seems valid according to the QGIS Schema.Ok, it seems valid according to the QGIS Schema.New CategoryNew CategoryNew Category:New Category:QgsMetadataWidgetBaseFormFormIdentificationIdentificationA reference, URI, URL or some other mechanism to identify the parent resource that this resource is a part (child) of.A reference, URI, URL or some other mechanism to identify the parent resource that this resource is a part (child) of.Parent identifierParent identifierA reference, URI, URL or some other mechanism to identify the resource.A reference, URI, URL or some other mechanism to identify the resource.IdentifierIdentifierSet from layerSet from layerReturns the human readable name of the resource, typically displayed in search results.Returns the human readable name of the resource, typically displayed in search results.TitleTitleWhile a formal vocabulary is not imposed, it is advised to use the ISO 19115 MD_ScopeCode values. E.g. 'dataset' or 'series'. If unsure about which type to select, use 'dataset'.While a formal vocabulary is not imposed, it is advised to use the ISO 19115 MD_ScopeCode values. E.g. 'dataset' or 'series'. If unsure about which type to select, use 'dataset'.TypeTypeCreation dateCreation dateyyyy-MM-dd HH:mm:ssyyyy-MM-dd HH:mm:ssAuthorAuthorUsually the returned string will follow either the ISO 639.2 or ISO 3166 specifications, e.g. 'ENG' or 'SPA', however this is not a hard requirement and the caller must account for non compliant values.Usually the returned string will follow either the ISO 639.2 or ISO 3166 specifications, e.g. 'ENG' or 'SPA', however this is not a hard requirement and the caller must account for non compliant values.LanguageLanguageFree-form description of the resourceFree-form description of the resourceAbstractAbstractEncodingEncodingCategoriesCategoriesISO categoriesISO categoriesCategories chosen will be added as a new entry in the keywords tab.Categories chosen will be added as a new entry in the keywords tab.Add selected ISO categories to metadataAdd selected ISO categories to metadataAdd a new custom category to the metadataAdd a new custom category to the metadataRemove selected categories from metadataRemove selected categories from metadataChosen categoriesChosen categoriesKeywordsKeywordsAdds a list of descriptive keywords for a specified vocabulary.Adds a list of descriptive keywords for a specified vocabulary.Removes a specified vocabulary.Removes a specified vocabulary.A set of descriptive keywords associated with the resource for a specified concept.A set of descriptive keywords associated with the resource for a specified concept.ConceptConceptAccessAccessThe fees, licences and rights for this dataset.The fees, licences and rights for this dataset.Any fees associated with using the resourceAny fees associated with using the resourceFeesFeesA list of licenses associated with the resourceA list of licenses associated with the resourceLicensesLicensesAdd licenseAdd licenseRemove licenseRemove licenseLabelLabelList of attribution or copyright strings associated with the resourceList of attribution or copyright strings associated with the resourceRights (attribution or copyright)Rights (attribution or copyright)Add RightAdd RightRemove RightRemove RightConstraintsConstraintsExtentExtentCoordinate Reference System and spatial extent for this dataset.Coordinate Reference System and spatial extent for this dataset.The coordinate reference system described by the layer's metadataThe coordinate reference system described by the layer's metadataCoordinate Reference SystemCoordinate Reference SystemSet CRS from layerSet CRS from layerSet CRS from providerSet CRS from providerZ maximumZ maximumZ minimumZ minimumTemporal extent for this dataset.Temporal extent for this dataset.FromFromToToContactContactPosition/title of contactPosition/title of contactName of contactName of contactRole of contactRole of contactRoleRolePositionPositionOrganization contact belongs to/representsOrganization contact belongs to/representsNameNamePhone numberPhone numberFax numberFax numberFaxFaxOrganizationOrganizationElectronic mail addressElectronic mail addressVoiceVoiceAddressAddressType of address, e.g 'postal'Type of address, e.g 'postal'Free-form physical address componentFree-form physical address componentPostal CodePostal CodePostal (or ZIP) codePostal (or ZIP) codeCityCityCity or locality nameCity or locality nameAdministrative AreaAdministrative AreaAdministrative area (state, province/territory, etc.)Administrative area (state, province/territory, etc.)CountryCountryFree-form countryFree-form countryEmailEmailAdd addressAdd addressRemove AddressRemove AddressLinksLinksa list of online resources associated with the resource.a list of online resources associated with the resource.Add linkAdd linkRemove linkRemove linkHistoryHistoryValidationValidationValidation is not enforced, but it's recommended to resolve any validation issues listed here.Validation is not enforced, but it's recommended to resolve any validation issues listed here.QgsMssqlConnectionItemEdit Connection…Edit Connection…Delete ConnectionDelete Connection%1: Not a valid layer!%1: Not a valid layer!%1: Not a vector layer!%1: Not a vector layer!RefreshRefreshShow Non-spatial TablesShow Non-spatial TablesCreate Schema…Create Schema…Create SchemaCreate SchemaSchema name:Schema name:Unable to create schema %1
%2Unable to create schema %1
%2Import to MSSQL databaseImport to MSSQL databaseFailed to import some layers!
Failed to import some layers!
Import was successful.Import was successful.QgsMssqlLayerItemDelete TableDelete TableTable deleted successfully.Table deleted successfully.Truncate TableTruncate TableTable truncated successfully.Table truncated successfully.QgsMssqlNewConnectionSave ConnectionSave ConnectionShould the existing connection %1 be overwritten?Should the existing connection %1 be overwritten?Testing connectionTesting connection…………Connection FailedConnection FailedHost name hasn't been specified.Host name hasn't been specified.Error opening connectionError opening connectionQgsMssqlNewConnectionBaseProvider/DSNProvider/DSNHostHostHEADS UP: You have opted to save your password. It will be stored in plain text in your project files and in your home directory on Unix-like systems, or in your user profile on Windows
Untick save if you don't wish to be the case.HEADS UP: You have opted to save your password. It will be stored in plain text in your project files and in your home directory on Unix-like systems, or in your user profile on Windows
Untick save if you don't wish to be the case.If checked, tables without a geometry column attached will also be shown in the available table lists.If checked, tables without a geometry column attached will also be shown in the available table lists.If checked, only estimated table metadata will be used. This avoids a slow table scan, but may result in incorrect layer properties such as layer extent.If checked, only estimated table metadata will be used. This avoids a slow table scan, but may result in incorrect layer properties such as layer extent.If checked, only tables which are present in the "geometry_columns" metadata table will be available. This speeds up table scanning, but requires users to manually manage the geometry_columns table and ensure that layers are correctly represented in the table.If checked, only tables which are present in the "geometry_columns" metadata table will be available. This speeds up table scanning, but requires users to manually manage the geometry_columns table and ensure that layers are correctly represented in the table.Test ConnectionTest ConnectionList DatabasesList DatabasesDatabaseDatabaseIf checked, all handling of records with invalid geometry will be disabled. This speeds up the provider, however, if any invalid geometries are present in a table then the result is unpredictable and may include missing records. Only check this option if you are certain that all geometries present in the database are valid, and any newly added geometries or tables will also be valid.If checked, all handling of records with invalid geometry will be disabled. This speeds up the provider, however, if any invalid geometries are present in a table then the result is unpredictable and may include missing records. Only check this option if you are certain that all geometries present in the database are valid, and any newly added geometries or tables will also be valid.Skip invalid geometry handlingSkip invalid geometry handlingUsernameUsernameCreate a New MSSQL ConnectionCreate a New MSSQL ConnectionConnection DetailsConnection DetailsConnection nameConnection nameLoginLoginTrusted connectionTrusted connectionSaveSavePasswordPasswordName of the new connectionName of the new connectionDatabase DetailsDatabase DetailsOnly look in the geometry_columns metadata tableOnly look in the geometry_columns metadata tableAlso list tables with no geometryAlso list tables with no geometryUse estimated table parametersUse estimated table parametersQgsMssqlProvider8 Bytes integer8 Bytes integer4 Bytes integer4 Bytes integer2 Bytes integer2 Bytes integer1 Bytes integer1 Bytes integerDecimal number (numeric)Decimal number (numeric)Decimal number (decimal)Decimal number (decimal)Decimal number (real)Decimal number (real)Decimal number (double)Decimal number (double)DateDateTimeTimeDate & TimeDate & TimeText, fixed length (char)Text, fixed length (char)Text, limited variable length (varchar)Text, limited variable length (varchar)Text, fixed length unicode (nchar)Text, fixed length unicode (nchar)Text, limited variable length unicode (nvarchar)Text, limited variable length unicode (nvarchar)Text, unlimited length (text)Text, unlimited length (text)Text, unlimited length unicode (ntext)Text, unlimited length unicode (ntext)Could not add feature with geometry type %1 to layer of type %2Could not add feature with geometry type %1 to layer of type %2Table [%1].[%2] already existsTable [%1].[%2] already existsQgsMssqlRootItemNew Connection…New Connection…QgsMssqlSchemaItemRefreshRefresh%1 as %2 in %3%1 as %2 in %3as geometryless tableas geometryless tableQgsMssqlSourceSelectAdd MSSQL Table(s)Add MSSQL Table(s)&Set Filter&Set FilterSet FilterSet FilterWildcardWildcardRegExpRegExpAllAllSchemaSchemaTableTableTypeTypeGeometry columnGeometry columnPrimary key columnPrimary key columnSRIDSRIDSqlSqlAre you sure you want to remove the %1 connection and all associated settings?Are you sure you want to remove the %1 connection and all associated settings?Confirm DeleteConfirm DeleteLoad ConnectionsLoad ConnectionsXML files (*.xml *.XML)XML files (*.xml *.XML)Select TableSelect TableYou must select a table in order to add a layer.You must select a table in order to add a layer.MSSQL ProviderMSSQL ProviderStopStopConnectConnectQgsMssqlSourceSelectDelegateSelect…Select…QgsMssqlTableModelSchemaSchemaTableTableTypeTypeGeometry columnGeometry columnSRIDSRIDPrimary key columnPrimary key columnSelect at idSelect at idSqlSqlDetecting…Detecting…Select…Select…Enter…Enter…Disable 'Fast Access to Features at ID' capability to force keeping the attribute table in memory (e.g. in case of expensive views).Disable 'Fast Access to Features at ID' capability to force keeping the attribute table in memory (e.g. in case of expensive views).QgsMultiBandColorRendererWidgetNo enhancementNo enhancementStretch to MinMaxStretch to MinMaxStretch and clip to MinMaxStretch and clip to MinMaxClip to MinMaxClip to MinMaxRedRedGreenGreenBlueBlueQgsMultiBandColorRendererWidgetBaseFormFormContrast
enhancementContrast
enhancementRed bandRed bandMinMinMaxMaxGreen bandGreen bandBlue bandBlue bandQgsMultiEditToolButtonSet field for all selected featuresSet field for all selected featuresNo Changes to CommitNo Changes to CommitSet %1 for All Selected FeaturesSet %1 for All Selected FeaturesReset to Original ValuesReset to Original ValuesAll features in selection have equal value for '%1'All features in selection have equal value for '%1'Some features in selection have different values for '%1'Some features in selection have different values for '%1'Values for '%1' have unsaved changesValues for '%1' have unsaved changesQgsNativeAlgorithmsQGIS (native c++)QGIS (native c++)QgsNetworkAccessManagerNetwork request %1 timed outNetwork request %1 timed outNetworkNetworkQgsNetworkContentFetcherHTTP fetch %1 failed with error %2HTTP fetch %1 failed with error %2QgsNetworkContentFetcherTaskFetching %1Fetching %1QgsNetworkReplyParserCannot find boundary in multipart content typeCannot find boundary in multipart content typeQgsNewAuxiliaryFieldDialogStringStringRealRealIntegerIntegerNew Auxiliary FieldNew Auxiliary FieldInvalid name. Auxiliary field '%1' already exists.Invalid name. Auxiliary field '%1' already exists.Name is a mandatory parameter.Name is a mandatory parameter.QgsNewAuxiliaryFieldDialogBaseAuxiliary Storage : New Auxiliary FieldAuxiliary Storage : New Auxiliary FieldNew auxiliary field parametersNew auxiliary field parametersTypeTypeNameNameQgsNewAuxiliaryLayerDialogBaseAuxiliary Storage : Choose Primary KeyAuxiliary Storage : Choose Primary KeySelect the primary key to use for joining with internal data storageSelect the primary key to use for joining with internal data storageQgsNewGeoPackageLayerDialogPointPointLineLinePolygonPolygonText dataText dataWhole number (integer)Whole number (integer)Whole number (integer 64 bit)Whole number (integer 64 bit)Decimal number (real)Decimal number (real)DateDateDate&timeDate&timeGeoPackageGeoPackageSelect Existing or Create a New GeoPackage Database File…Select Existing or Create a New GeoPackage Database File…Creation of database failed (OGR error: %1)Creation of database failed (OGR error: %1)Opening of database failed (OGR error: %1)Opening of database failed (OGR error: %1)Opening of file succeeded, but this is not a GeoPackage database.Opening of file succeeded, but this is not a GeoPackage database.A table with the same name already exists. Do you want to overwrite it?A table with the same name already exists. Do you want to overwrite it?OverwriteOverwriteNo geometryNo geometryMultiPointMultiPointMultiLineMultiLineMultiPolygonMultiPolygonCircularStringCircularStringCompoundCurveCompoundCurveCurvePolygonCurvePolygonMultiCurveMultiCurveMultiSurfaceMultiSurfaceAdd FieldAdd FieldThe field cannot have the same name as the feature identifier.The field cannot have the same name as the feature identifier.New GeoPackage LayerNew GeoPackage LayerThe File already exists. Do you want to overwrite the existing file with a new database or add a new layer to it?The File already exists. Do you want to overwrite the existing file with a new database or add a new layer to it?Layer creation failed. GeoPackage driver not found.Layer creation failed. GeoPackage driver not found.Add new layerAdd new layerCreation of layer failed (OGR error: %1)Creation of layer failed (OGR error: %1)Creation of field %1 failed (OGR error: %2)Creation of field %1 failed (OGR error: %2)%1 is an invalid layer and cannot be loaded.%1 is an invalid layer and cannot be loaded.QgsNewGeoPackageLayerDialogBaseNew GeoPackage LayerNew GeoPackage LayerCreate a spatial indexCreate a spatial indexMaximum lengthMaximum lengthNameNameAdd field to listAdd field to listTypeType<html><head/><body><p>Field length / width</p></body></html><html><head/><body><p>Field length / width</p></body></html>Include Z dimensionInclude Z dimensionInclude M valuesInclude M values<html><head/><body><p>Human-readable identifier (e.g. short name) for the layer content</p></body></html><html><head/><body><p>Human-readable identifier (e.g. short name) for the layer content</p></body></html><html><head/><body><p>Name of the geometry column</p></body></html><html><head/><body><p>Name of the geometry column</p></body></html>Create a spatial index for this layerCreate a spatial index for this layer<html><head/><body><p>Existing or new GeoPackage database file name</p></body></html><html><head/><body><p>Existing or new GeoPackage database file name</p></body></html>Layer descriptionLayer descriptionGeometry typeGeometry typeGeometry columnGeometry column<html><head/><body><p>Table name in the database</p></body></html><html><head/><body><p>Table name in the database</p></body></html><html><head/><body><p>Human-readable description for the layer content</p></body></html><html><head/><body><p>Human-readable description for the layer content</p></body></html>DatabaseDatabaseNew FieldNew FieldAdd to Fields ListAdd to Fields ListTable nameTable nameFields ListFields ListRemove FieldRemove FieldAdvanced OptionsAdvanced OptionsLayer identifierLayer identifier<html><head/><body><p>Geometry type</p></body></html><html><head/><body><p>Geometry type</p></body></html>Feature id columnFeature id column<html><head/><body><p>Name of the feature id column</p></body></html><html><head/><body><p>Name of the feature id column</p></body></html>Delete selected fieldDelete selected fieldLengthLengthQgsNewHttpConnectionCreate a New %1 ConnectionCreate a New %1 ConnectionallalloffoffQGISQGISUMNUMNGeoServerGeoServerMaximumMaximum1.01.01.11.12.02.0WCS OptionsWCS OptionsSave ConnectionSave ConnectionSaving PasswordsSaving PasswordsWARNING: You have entered a password. It will be stored in unsecured plain text in your project files and your home directory (Unix-like OS) or user profile (Windows). If you want to avoid this, press Cancel and either:
a) Don't provide a password in the connection settings — it will be requested interactively when needed;
b) Use the Configuration tab to add your credentials in an HTTP Basic Authentication method and store them in an encrypted database.WARNING: You have entered a password. It will be stored in unsecured plain text in your project files and your home directory (Unix-like OS) or user profile (Windows). If you want to avoid this, press Cancel and either:
a) Don't provide a password in the connection settings — it will be requested interactively when needed;
b) Use the Configuration tab to add your credentials in an HTTP Basic Authentication method and store them in an encrypted database.Ignore GetCoverage URI reported in capabilitiesIgnore GetCoverage URI reported in capabilitiesIgnore axis orientationIgnore axis orientationShould the existing connection %1 be overwritten?Should the existing connection %1 be overwritten?QgsNewHttpConnectionBaseAuthenticationAuthenticationURLURLVersionVersionMax. number of featuresMax. number of featuresNameNameName of the new connectionName of the new connectionHTTP address of the Web Map ServerHTTP address of the Web Map ServerIgnore GetFeatureInfo URI reported in capabilitiesIgnore GetFeatureInfo URI reported in capabilitiesWFS OptionsWFS OptionsIgnore axis orientation (WFS 1.1/WFS 2.0)Ignore axis orientation (WFS 1.1/WFS 2.0)&Test Connection&Test ConnectionIgnore GetMap/GetTile URI reported in capabilitiesIgnore GetMap/GetTile URI reported in capabilitiesIgnore axis orientation (WMS 1.3/WMTS)Ignore axis orientation (WMS 1.3/WMTS)Invert axis orientationInvert axis orientationCreate a New ConnectionCreate a New ConnectionConnection DetailsConnection Details<html><head/><body><p>Enter a number to limit the maximum number of features retrieved per feature request. If let to empty, no limit is set.</p></body></html><html><head/><body><p>Enter a number to limit the maximum number of features retrieved per feature request. If let to empty, no limit is set.</p></body></html>DetectDetectEnable feature pagingEnable feature pagingPage sizePage size<html><head/><body><p>Enter a number to limit the maximum number of features retrieved in a single GetFeature request when paging is enabled. If let to empty, server default will apply.</p></body></html><html><head/><body><p>Enter a number to limit the maximum number of features retrieved in a single GetFeature request when paging is enabled. If let to empty, server default will apply.</p></body></html>WMS/WMTS OptionsWMS/WMTS OptionsSmooth pixmap transformSmooth pixmap transformDPI-&ModeDPI-&Mode&Referer&RefererQgsNewMemoryLayerDialogNew scratch layerNew scratch layerNo geometryNo geometryPointPointLineString / CompoundCurveLineString / CompoundCurvePolygon / CurvePolygonPolygon / CurvePolygonMultiPointMultiPointMultiLineString / MultiCurveMultiLineString / MultiCurveMultiPolygon / MultiSurfaceMultiPolygon / MultiSurfaceQgsNewMemoryLayerDialogBaseNew Temporary Scratch LayerNew Temporary Scratch LayerInclude M valuesInclude M valuesGeometry typeGeometry typeLayer nameLayer nameInclude Z dimensionInclude Z dimension<i><b>Warning:</b> Temporary scratch layers are not saved and will be discarded when QGIS is closed.</i><i><b>Warning:</b> Temporary scratch layers are not saved and will be discarded when QGIS is closed.</i>QgsNewNameDialogNew NameNew Namenamenamebase namebase nameEnter new %1Enter new %1Enter new %1 for %2Enter new %1 for %2Full namesFull names%n Name(s) %1 exists%n Name(s) %1 exists%n Name(s) %1 existsOverwriteOverwriteQgsNewOgrConnectionConnection failed - Check settings and try again.
Extended error information:
%1Connection failed - Check settings and try again.
Extended error information:
%1Test ConnectionTest ConnectionConnection to %1 was successful.Connection to %1 was successful.Save ConnectionSave ConnectionShould the existing connection %1 be overwritten?Should the existing connection %1 be overwritten?QgsNewOgrConnectionBaseCreate a New OGR Database ConnectionCreate a New OGR Database ConnectionConnection InformationConnection Information&Test Connection&Test ConnectionAuthenticationAuthentication&Type&Type&Name&Name&Database&DatabaseName of the new connectionName of the new connectionHostHostPortPortQgsNewSpatialiteLayerDialogNo geometryNo geometryPointPointLineLinePolygonPolygonMultiPointMultiPointMultiLineMultiLineMultiPolygonMultiPolygonText dataText dataWhole numberWhole numberDecimal numberDecimal numberNew SpatiaLite Database FileNew SpatiaLite Database FileSpatiaLiteSpatiaLiteSpatiaLite DatabaseSpatiaLite DatabaseUnable to open the databaseUnable to open the databaseErrorErrorFailed to load SRIDS: %1Failed to load SRIDS: %1New SpatiaLite LayerNew SpatiaLite LayerThe file already exists. Do you want to overwrite the existing file with a new database or add a new layer to it?The file already exists. Do you want to overwrite the existing file with a new database or add a new layer to it?OverwriteOverwriteAdd new layerAdd new layer@@Unable to open the database: %1Unable to open the database: %1Error Creating SpatiaLite TableError Creating SpatiaLite TableFailed to create the SpatiaLite table %1. The database returned:
%2Failed to create the SpatiaLite table %1. The database returned:
%2Error Creating Geometry ColumnError Creating Geometry ColumnFailed to create the geometry column. The database returned:
%1Failed to create the geometry column. The database returned:
%1Error Creating Spatial IndexError Creating Spatial IndexFailed to create the spatial index. The database returned:
%1Failed to create the spatial index. The database returned:
%1%1 is an invalid layer and cannot be loaded.%1 is an invalid layer and cannot be loaded.QgsNewSpatialiteLayerDialogBaseDatabaseDatabaseLayer nameLayer nameName for the new layerName for the new layerGeometry columnGeometry columnTypeTypeSpatial Reference IdSpatial Reference IdSpecify the coordinate reference system of the layer's geometry.Specify the coordinate reference system of the layer's geometry.Add an integer id field as the primary key for the new layerAdd an integer id field as the primary key for the new layerCreate an autoincrementing primary keyCreate an autoincrementing primary keyNew SpatiaLite LayerNew SpatiaLite LayerCreate a new SpatiaLite databaseCreate a new SpatiaLite database……Geometry typeGeometry type<html><head/><body><p>Geometry type</p></body></html><html><head/><body><p>Geometry type</p></body></html>Include Z dimensionInclude Z dimensionInclude M valuesInclude M valuesNew FieldNew FieldA field nameA field nameAdd field to listAdd field to listAdd to Fields ListAdd to Fields ListRemove FieldRemove FieldFields ListFields ListDelete selected fieldDelete selected fieldAdvanced OptionsAdvanced OptionsName of the geometry columnName of the geometry columnNameNameQgsNewVectorLayerDialogText dataText dataWhole numberWhole numberDecimal numberDecimal numberDateDatePointPointLineLinePolygonPolygonESRI ShapefileESRI ShapefileComma Separated ValueComma Separated ValueGMLGMLMapinfo FileMapinfo FileSave Layer AsSave Layer AsQgsNewVectorLayerDialogBaseFile formatFile formatTypeTypeLengthLengthAdd field to listAdd field to listDelete selected fieldDelete selected fieldFile nameFile nameInclude Z dimensionInclude Z dimensionInclude M valuesInclude M valuesNameNameNew Shapefile LayerNew Shapefile LayerNew FieldNew FieldPrecisionPrecisionAdd to Fields ListAdd to Fields ListFields ListFields ListRemove FieldRemove FieldGeometry typeGeometry typeFile encodingFile encodingQgsNullSymbolRendererWidgetNo symbols will be rendered for features in this layer.No symbols will be rendered for features in this layer.QgsOWSConnectionItemEdit…Edit…DeleteDeleteQgsOWSRootItemNew Connection…New Connection…QgsOWSSourceSelectAdd Layer(s) from a %1 ServerAdd Layer(s) from a %1 ServerAlways cacheAlways cachePrefer cachePrefer cachePrefer networkPrefer networkAlways networkAlways networkAre you sure you want to remove the %1 connection and all associated settings?Are you sure you want to remove the %1 connection and all associated settings?Delete ConnectionDelete ConnectionXML files (*.xml *.XML)XML files (*.xml *.XML)Add WMS ServersAdd WMS ServersSeveral WMS servers have been added to the server list. Note that if you access the Internet via a web proxy, you will need to set the proxy settings in the QGIS options dialog.Several WMS servers have been added to the server list. Note that if you access the Internet via a web proxy, you will need to set the proxy settings in the QGIS options dialog.Load ConnectionsLoad ConnectionsCoordinate Reference System (%n available)crs countCoordinate Reference System (%n available)Coordinate Reference System (%n available)Coordinate Reference SystemCoordinate Reference SystemCould not understand the response:
%1Could not understand the response:
%1parse error at row %1, column %2: %3parse error at row %1, column %2: %3network error: %1network error: %1QgsOWSSourceSelectBaseAdd Layer(s) from a ServerAdd Layer(s) from a ServerReadyReadyLayersLayersConnect to selected serviceConnect to selected serviceC&onnectC&onnectCreate a new service connectionCreate a new service connection&New&NewEdit selected service connectionEdit selected service connectionEditEditLoad connections from fileLoad connections from fileLoadLoadSave connections to fileSave connections to fileSaveSaveAdds a few example WMS serversAdds a few example WMS serversIDIDNameNameTitleTitleAbstractAbstractTimeTimeRemove connection to selected serviceRemove connection to selected serviceRemoveRemoveAdd Default ServersAdd Default ServersCoordinate Reference SystemCoordinate Reference SystemSelected Coordinate Reference SystemSelected Coordinate Reference SystemChange...Change...FormatFormatOptionsOptionsLayer nameLayer nameTile sizeTile sizeFeature limit for GetFeatureInfoFeature limit for GetFeatureInfoCacheCacheCache preference
Always cache: load from cache, even if it expired
Prefer cache: load from cache if available, otherwise load from network. Note that this can return possibly stale (but not expired) items from cache
Prefer network: default value; load from the network if the cached entry is older than the network entry
Always network: always load from network and do not check if the cache has a valid entry (similar to the "Reload" feature in browsers)
Cache preference
Always cache: load from cache, even if it expired
Prefer cache: load from cache if available, otherwise load from network. Note that this can return possibly stale (but not expired) items from cache
Prefer network: default value; load from the network if the cached entry is older than the network entry
Always network: always load from network and do not check if the cache has a valid entry (similar to the "Reload" feature in browsers)
Layer OrderLayer OrderMove selected layer UPMove selected layer UPUpUpMove selected layer DOWNMove selected layer DOWNDownDownLayerLayerStyleStyleTilesetsTilesetsStylesStylesSizeSizeCRSCRSServer SearchServer SearchSearchSearchDescriptionDescriptionURLURLAdd Selected Row to WMS ListAdd Selected Row to WMS ListQgsOfflineEditingCould not open the SpatiaLite databaseCould not open the SpatiaLite databaseUnable to initialize SpatialMetadata:
Unable to initialize SpatialMetadata:
Creation of database failed. GeoPackage driver not found.Creation of database failed. GeoPackage driver not found.Creation of database failed (OGR error: %1)Creation of database failed (OGR error: %1)Could not create a new database
Could not create a new database
Unable to activate FOREIGN_KEY constraintsUnable to activate FOREIGN_KEY constraintsLayer %1 has unsupported geometry type %2.Layer %1 has unsupported geometry type %2.Layer %1 has unsupported Coordinate Reference System (%2).Layer %1 has unsupported Coordinate Reference System (%2).Filling SpatiaLite for layer %1 failedFilling SpatiaLite for layer %1 failed%1 (offline)%1 (offline)Cannot make FID-name for GPKG Cannot make FID-name for GPKG Creation of layer failed (OGR error: %1)Creation of layer failed (OGR error: %1)Creation of field %1 failed (OGR error: %2)Creation of field %1 failed (OGR error: %2)Feature cannot be copied to the offline layer, please check if the online layer '%1' is still accessible.Feature cannot be copied to the offline layer, please check if the online layer '%1' is still accessible.Offline Editing PluginOffline Editing PluginCould not open the SpatiaLite logging databaseCould not open the SpatiaLite logging database%1: Unknown data type %2. Not using type affinity for the field.%1: Unknown data type %2. Not using type affinity for the field.QgsOfflineEditingPluginCreate offline copies of selected layers and save as offline projectCreate offline copies of selected layers and save as offline project&Offline Editing&Offline EditingSynchronizeSynchronizeSynchronize offline project with remote layersSynchronize offline project with remote layersConvert to Offline Project…Convert to Offline Project…Converting to Offline ProjectConverting to Offline ProjectSynchronizing to Remote LayersSynchronizing to Remote Layers%v / %m features copied%v / %m features copied%v / %m features processed%v / %m features processed%v / %m fields added%v / %m fields added%v / %m features added%v / %m features added%v / %m features removed%v / %m features removed%v / %m feature updates%v / %m feature updates%v / %m feature geometry updates%v / %m feature geometry updatesQgsOfflineEditingPluginGuiSelect target database for offline dataSelect target database for offline dataSpatiaLite DBSpatiaLite DBAll filesAll filesGeoPackageGeoPackageOffline Editing PluginOffline Editing PluginConverting to offline project.Converting to offline project.Offline database file '%1' exists. Overwrite?Offline database file '%1' exists. Overwrite?QgsOfflineEditingPluginGuiBaseCreate Offline ProjectCreate Offline ProjectStorage typeStorage typeGeoPackageGeoPackageSpatiaLiteSpatiaLiteOffline dataOffline dataBrowse...Browse...Select remote layersSelect remote layersSelect allSelect allDeselect allDeselect allOnly synchronize selected features if a selection is presentOnly synchronize selected features if a selection is presentQgsOfflineEditingProgressDialogLayer %1 of %2..Layer %1 of %2..QgsOfflineEditingProgressDialogBaseDialogDialogTextLabelTextLabelQgsOffsetUserInputBaseFormFormOffsetOffset......Join styleJoin styleQuadrant segmentsQuadrant segmentsMiter limitMiter limitCap styleCap styleQgsOffsetUserWidgetRoundRoundMiterMiterBevelBevelFlatFlatSquareSquareQgsOgrDataCollectionItemCannot add connection '%1'Cannot add connection '%1'A connection with the same name already exists,
please provide a new name:A connection with the same name already exists,
please provide a new name:Open %1Open %1FolderFolderFileFilefolderfolderfilefileCould not delete %1.Could not delete %1.%1 deleted successfully.%1 deleted successfully.QgsOgrDbSourceSelectAdd %1 Layer(s)Add %1 Layer(s)&Set Filter&Set FilterWildcardWildcardRegExpRegExpAllAllTableTableTypeTypeGeometry columnGeometry columnSqlSql@@Are you sure you want to remove the %1 connection and all associated settings?Are you sure you want to remove the %1 connection and all associated settings?Confirm DeleteConfirm DeleteSelect TableSelect TableYou must select a table in order to add a Layer.You must select a table in order to add a Layer.QgsOgrDbTableModelTableTableTypeTypeGeometry columnGeometry columnSqlSqlQgsOgrLayerItemCouldn't open file %1.prjCouldn't open file %1.prjOGROGRCouldn't open file %1.qpjCouldn't open file %1.qpjLayer deleted successfully.Layer deleted successfully.File deleted successfully.File deleted successfully.QgsOgrProviderOGROGRBooleanBooleanAutogenerateAutogenerateOGR error committing transaction: %1OGR error committing transaction: %1Data source is invalid (%1)Data source is invalid (%1)Whole number (integer)Whole number (integer)Whole number (integer 64 bit)Whole number (integer 64 bit)Decimal number (real)Decimal number (real)Text (string)Text (string)DateDateTimeTimeDate & TimeDate & TimeOGR[%1] error %2: %3OGR[%1] error %2: %3OGR error creating wkb for feature %1: %2OGR error creating wkb for feature %1: %2Feature has too many attributes (expecting %1, received %2)Feature has too many attributes (expecting %1, received %2)type %1 for attribute %2 not foundtype %1 for attribute %2 not foundOGR error creating feature %1: %2OGR error creating feature %1: %2type %1 for field %2 not foundtype %1 for field %2 not foundOGR error creating field %1: %2OGR error creating field %1: %2Cannot delete feature id columnCannot delete feature id columnOGR error deleting field %1: %2OGR error deleting field %1: %2Invalid attribute indexInvalid attribute indexError renaming field %1: name '%2' already existsError renaming field %1: name '%2' already existsOGR error renaming field %1: %2OGR error renaming field %1: %2Feature %1 for attribute update not found.Feature %1 for attribute update not found.Changing feature id of feature %1 is not allowed.Changing feature id of feature %1 is not allowed.Field %1 of feature %2 doesn't exist.Field %1 of feature %2 doesn't exist.Type %1 of attribute %2 of feature %3 unknown.Type %1 of attribute %2 of feature %3 unknown.OGR error setting feature %1: %2OGR error setting feature %1: %2OGR error syncing to disk: %1OGR error syncing to disk: %1OGR error changing geometry: feature %1 not foundOGR error changing geometry: feature %1 not foundOGR error creating geometry for feature %1: %2OGR error creating geometry for feature %1: %2OGR error in feature %1: geometry is nullOGR error in feature %1: geometry is nullOGR error setting geometry of feature %1: %2OGR error setting geometry of feature %1: %2Cannot reopen datasource %1Cannot reopen datasource %1Cannot reopen datasource %1 in update modeCannot reopen datasource %1 in update modeUnbalanced call to leaveUpdateMode() w.r.t. enterUpdateMode()Unbalanced call to leaveUpdateMode() w.r.t. enterUpdateMode()Cannot reopen datasource %1 in read-only modeCannot reopen datasource %1 in read-only modePossible corruption after REPACK detected. %1 still exists. This may point to a permission or locking problem of the original DBF.Possible corruption after REPACK detected. %1 still exists. This may point to a permission or locking problem of the original DBF.Original layer could not be reopened.Original layer could not be reopened.OGR error deleting feature %1: %2OGR error deleting feature %1: %2Shapefiles without attribute are considered read-only.Shapefiles without attribute are considered read-only.QgsOgrSourceSelect Additional credential options are required as documented <a href="%1">here</a>. Additional credential options are required as documented <a href="%1">here</a>.Open OGR Supported Vector Dataset(s)Open OGR Supported Vector Dataset(s)Are you sure you want to remove the %1 connection and all associated settings?Are you sure you want to remove the %1 connection and all associated settings?Confirm DeleteConfirm DeleteAdd vector layerAdd vector layerNo database selected.No database selected.Password for Password for Please enter your password:Please enter your password:No protocol URI entered.No protocol URI entered.No protocol bucket and/or key entered.No protocol bucket and/or key entered.No layers selected.No layers selected.No directory selected.No directory selected.Open an OGR Supported Vector LayerOpen an OGR Supported Vector LayerOpen DirectoryOpen DirectoryQgsOgrSourceSelectBaseAdd Vector LayerAdd Vector LayerF&ileF&ile&Directory&DirectoryDa&tabaseDa&tabaseEncodingEncodingProtocolProtocol&URI&URITypeTypeSource TypeSource TypeProtoco&l: HTTP(S), cloud, etc.Protoco&l: HTTP(S), cloud, etc.Bucket or containerBucket or containerObject keyObject key......AuthenticationAuthenticationSourceSourceVector Dataset(s)Vector Dataset(s)DatabaseDatabaseConnectionsConnectionsNewNewEditEditDeleteDeleteQgsOpacityWidget % %QgsOpacityWidgetPluginA widget for specifying an opacity value.A widget for specifying an opacity value.QgsOptionDialogTemplateOptions Dialog TemplateOptions Dialog TemplateGroupBoxGroupBoxQgsOptionsnot presentnot presentSystem value: %1System value: %1Show all featuresShow all featuresShow selected featuresShow selected featuresRemember last viewRemember last viewTable viewTable viewForm viewForm viewAllAllAlwaysAlwaysIf neededIf neededNeverNeverLoad allLoad allCheck file contentsCheck file contentsCheck extensionCheck extensionNoNoBasic scanBasic scanFull scanFull scanMetersMetersKilometersKilometersFeetFeetYardsYardsMilesMilesNautical milesNautical milesDegreesDegreesMap unitsMap unitsSquare metersSquare metersSquare kilometersSquare kilometersSquare feetSquare feetSquare yardsSquare yardsSquare milesSquare milesHectaresHectaresAcresAcresSquare nautical milesSquare nautical milesSquare degreesSquare degreesRadiansRadiansGon/gradiansGon/gradiansMinutes of arcMinutes of arcSeconds of arcSeconds of arcTurns/revolutionsTurns/revolutionsMaximum angleMaximum angleMaximum differenceMaximum differenceDistanceDistanceSnapToGridSnapToGridVisvalingamVisvalingamPlain text, no geometryPlain text, no geometryPlain text, WKT geometryPlain text, WKT geometryGeoJSONGeoJSONSet Selection ColorSet Selection ColorSet Canvas ColorSet Canvas ColorSet Measuring Tool ColorSet Measuring Tool ColorSelect Grid ColorSelect Grid ColorVertexVertexVertex and segmentVertex and segmentSegmentSegmentDialogDialogDockDockMiterMiterAn OpenCL compatible device was not found on your system.<br>You may need to install additional libraries in order to enable OpenCL.<br>Please check your logs for further details.An OpenCL compatible device was not found on your system.<br>You may need to install additional libraries in order to enable OpenCL.<br>Please check your logs for further details.AccelerationAccelerationSave Default ProjectSave Default ProjectRestore UI DefaultsRestore UI DefaultsStretch to MinMaxStretch to MinMaxStretch and Clip to MinMaxStretch and Clip to MinMaxClip to MinMaxClip to MinMaxSample date: %1 money: %2 int: %3 float: %4Sample date: %1 money: %2 int: %3 float: %4Set ScaleSet ScaleCumulative pixel count cutCumulative pixel count cutMinimum / maximumMinimum / maximumMean +/- standard deviationMean +/- standard deviationSolidSolidDotsDotsCrossesCrossesDetected active locale on your system: %1Detected active locale on your system: %1map unitsmap unitspixelspixelsSemi transparent circleSemi transparent circleCrossCrossNoneNoneQGIS filesQGIS filesSelect colorSelect colorThe text you entered is not a valid scale.The text you entered is not a valid scale.OffOffIdentify Highlight ColorIdentify Highlight ColorQGISQGISGEOSGEOSRoundRoundBevelBevelYou must set a default projectYou must set a default projectCurrent project saved as defaultCurrent project saved as defaultError saving current project as defaultError saving current project as defaultChoose a directory to store project template filesChoose a directory to store project template filesShow features visible on mapShow features visible on mapChoose project file to open at launchChoose project file to open at launchCreate Options - %1 DriverCreate Options - %1 DriverCreate Options - pyramidsCreate Options - pyramidsAre you sure to reset the UI to default (needs restart)?Are you sure to reset the UI to default (needs restart)?OverwriteOverwriteIf UndefinedIf UndefinedUnsetUnsetPrependPrependAppendAppendChoose a directoryChoose a directoryClear CacheClear CacheContent cache has been cleared.Content cache has been cleared.Connection authentication cache has been cleared.Connection authentication cache has been cleared.Enter scaleEnter scaleScale denominatorScale denominatorLoad scalesLoad scalesXML files (*.xml *.XML)XML files (*.xml *.XML)Save scalesSave scalesNo StretchNo StretchNone / PlanimetricNone / PlanimetricQgsOptionsBaseOptionsOptionsGeneralGeneralSystemSystemData SourcesData SourcesData sourcesData sourcesRenderingRenderingColorsColorsCanvas & LegendCanvas & LegendCanvas and legendCanvas and legendMap ToolsMap ToolsMap toolsMap toolsDigitizingDigitizingGDALGDALCRSCRSNetworkNetworkApplicationApplicationStyle <i>(QGIS restart required)</i>Style <i>(QGIS restart required)</i>Icon sizeIcon size161624243232FontFontSizeSizeTimeout for timed messages or dialogsTimeout for timed messages or dialogs s sHide splash screen at startupHide splash screen at startupQGIS-styled group boxesQGIS-styled group boxesProject filesProject filesNewNewMost recentMost recentSpecificSpecificOpen project on launchOpen project on launchCreate new project from default projectCreate new project from default projectSet current project as defaultSet current project as defaultReset defaultReset defaultTemplate folderTemplate folderResetResetPrompt to save project and data source changes when requiredPrompt to save project and data source changes when requiredPrompt for confirmation when a layer is to be removedPrompt for confirmation when a layer is to be removedWarn when opening a project file saved with an older version of QGISWarn when opening a project file saved with an older version of QGISEnable macrosEnable macrosNeverNeverAskAskFor this session onlyFor this session onlyAlways (not recommended)Always (not recommended)EnvironmentEnvironmentApplyApplyVariableVariableValueValueCurrent environment variables (read-only - bold indicates modified at startup)Current environment variables (read-only - bold indicates modified at startup)Show only QGIS-specific variablesShow only QGIS-specific variablesUse custom variables (restart required - include separators)Use custom variables (restart required - include separators)Plugin pathsPlugin pathsPath(s) to search for additional C++ plugins librariesPath(s) to search for additional C++ plugins librariesSVG pathsSVG pathsAuthenticationAuthenticationVariablesVariablesAdvancedAdvancedUI ThemeUI Theme48486464&Qt default&Qt defaultCheck QGIS version at startupCheck QGIS version at startupUse native color chooser dialogsUse native color chooser dialogsWelcome PageWelcome PagePath(s) to search for Scalable Vector Graphic (SVG) symbolsPath(s) to search for Scalable Vector Graphic (SVG) symbolsReset user interface to default settings (restart required)Reset user interface to default settings (restart required)Feature attributes and tableFeature attributes and tableAttribute table row cacheAttribute table row cacheRepresentation for NULL valuesRepresentation for NULL valuesLayoutsLayoutsPrint layoutsPrint layoutsLocatorLocatorOverride system &localeOverride system &locale<b>Note:</b> Enabling / changing override on locale requires an application restart<b>Note:</b> Enabling / changing override on locale requires an application restartDetected active locale on your systemDetected active locale on your systemModeless data source manager dialogModeless data source manager dialogA modeless dialog allows you to interact with QGIS main window and dialogs.A modeless dialog allows you to interact with QGIS main window and dialogs.AccelerationAccelerationConfigure GPU for processing algorithmsConfigure GPU for processing algorithmsLocale (numbers, date and currency formats)Locale (numbers, date and currency formats)User Interface TranslationUser Interface TranslationShow group (thousand) separatorShow group (thousand) separatorThis locale is used for number representation.This locale is used for number representation.Sample text for locale formattingSample text for locale formattingSelect fileSelect fileSelect folderSelect folderAdd new pathAdd new pathRemove pathRemove pathDocumentation pathsDocumentation pathsLower selected path priorityLower selected path priority……Path(s) to search for QGIS helpPath(s) to search for QGIS helpRaise selected path priorityRaise selected path prioritySettingsSettingsRemove variableRemove variableAdd new variableAdd new variable&Use a default CRS&Use a default CRSEnter default datum transformations which will be used in any newly created projectEnter default datum transformations which will be used in any newly created projectAsk for datum transformation if several are availableAsk for datum transformation if several are availableAttribute table behaviorAttribute table behaviorDefault viewDefault viewCopy features asCopy features asData source handlingData source handlingScan for valid items in the browser dockScan for valid items in the browser dockScan for contents of compressed files (.zip) in browser dockScan for contents of compressed files (.zip) in browser dockPrompt for raster sublayers when openingPrompt for raster sublayers when openingMap TipsMap TipsDelay (ms)Delay (ms)Color schemesColor schemesDon't update rubber band during vertex editingDon't update rubber band during vertex editingEnable snapping on invisible features (not shown on the map canvas)Enable snapping on invisible features (not shown on the map canvas)Layout defaultsLayout defaultsLayout PathsLayout Paths<html><head/><body><p>Changes on this page are dangerous and can break your QGIS installation in various ways. Any change you make is applied immediately, without clicking the <span style=" font-style:italic;">OK</span> button.</p></body></html><html><head/><body><p>Changes on this page are dangerous and can break your QGIS installation in various ways. Any change you make is applied immediately, without clicking the <span style=" font-style:italic;">OK</span> button.</p></body></html><html><head/><body><p>Some of the internal C++ processing core algorithms and renderers can take advantage of an OpenCL compatible device to increase the performances.<br/><span style=" font-weight:600;">QGIS OpenCL support is highly experimental and can crash QGIS because of bugs in the underlying libraries, enable at your own risk!</span></p></body></html><html><head/><body><p>Some of the internal C++ processing core algorithms and renderers can take advantage of an OpenCL compatible device to increase the performances.<br/><span style=" font-weight:600;">QGIS OpenCL support is highly experimental and can crash QGIS because of bugs in the underlying libraries, enable at your own risk!</span></p></body></html>The following OpenCL devices were found on this system (changing the default device requires QGIS to be restarted).The following OpenCL devices were found on this system (changing the default device requires QGIS to be restarted).<!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.0//EN" "http://www.w3.org/TR/REC-html40/strict.dtd">
<html><head><meta name="qrichtext" content="1" /><style type="text/css">
p, li { white-space: pre-wrap; }
</style></head><body style=" font-family:'Noto Sans'; font-size:9pt; font-weight:400; font-style:normal;">
<p style=" margin-top:0px; margin-bottom:0px; margin-left:0px; margin-right:0px; -qt-block-indent:0; text-indent:0px;">Placemark for OpenCL information results (mGPUInfoTextBrowser)</p></body></html><!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.0//EN" "http://www.w3.org/TR/REC-html40/strict.dtd">
<html><head><meta name="qrichtext" content="1" /><style type="text/css">
p, li { white-space: pre-wrap; }
</style></head><body style=" font-family:'Noto Sans'; font-size:9pt; font-weight:400; font-style:normal;">
<p style=" margin-top:0px; margin-bottom:0px; margin-left:0px; margin-right:0px; -qt-block-indent:0; text-indent:0px;">Placemark for OpenCL information results (mGPUInfoTextBrowser)</p></body></html>Enable OpenCL accelerationEnable OpenCL accelerationImport Palette...Import Palette...Import palette from fileImport palette from fileRemove PaletteRemove PaletteRemove current paletteRemove current paletteNew Palette...New Palette...Create a new paletteCreate a new paletteShow in Color ButtonsShow in Color ButtonsHidden browser pathsHidden browser pathsPaths hidden from browser panelPaths hidden from browser panelRendering behaviorRendering behaviorBy default new la&yers added to the map should be displayedBy default new la&yers added to the map should be displayedUse render caching where possible to speed up redrawsUse render caching where possible to speed up redrawsRender layers in parallel using many CPU coresRender layers in parallel using many CPU coresEnable feature si&mplification by default for newly added layersEnable feature si&mplification by default for newly added layersMagnification levelMagnification levelRendering qualityRendering qualityMake lines appear less jagged at the expense of some drawing performanceMake lines appear less jagged at the expense of some drawing performanceCurve segmentationCurve segmentationSegmentation toleranceSegmentation toleranceTolerance typeTolerance typeRastersRastersRGB band selectionRGB band selectionRed bandRed bandGreen bandGreen bandBlue bandBlue bandContrast enhancementContrast enhancementSingle band graySingle band grayMulti band color (byte / band) Multi band color (byte / band) Multi band color (> byte / band) Multi band color (> byte / band) Limits (minimum/maximum)Limits (minimum/maximum)Open new attribute tables as docked windowsOpen new attribute tables as docked windowsAdd PostGIS layers with double-click and select in extended modeAdd PostGIS layers with double-click and select in extended modeAdd Oracle layers with double-click and select in extended modeAdd Oracle layers with double-click and select in extended mode<html><head/><body><p>When digitizing a new feature, default values are retrieved from the database. With this option turned on, the default values will be evaluated at the time of digitizing. With this option turned off, the default values will be evaluated at the time of saving.</p></body></html><html><head/><body><p>When digitizing a new feature, default values are retrieved from the database. With this option turned on, the default values will be evaluated at the time of digitizing. With this option turned off, the default values will be evaluated at the time of saving.</p></body></html>Evaluate default valuesEvaluate default valuesMax cores to useMax cores to useSimplification threshold (higher values result in more simplification)Simplification threshold (higher values result in more simplification)This algorithm is only applied to simplify on local sideThis algorithm is only applied to simplify on local sideSimplification algorithmSimplification algorithmMaximum scale at which the layer should be simplified (1:1 always simplifies)Maximum scale at which the layer should be simplified (1:1 always simplifies)AlgorithmAlgorithmCumulative pixel count cut limitsCumulative pixel count cut limits--%%Standard deviation multiplierStandard deviation multiplierDebuggingDebuggingShow these events in the Log Message panel (under Rendering tab)Show these events in the Log Message panel (under Rendering tab)Map canvas refreshMap canvas refreshDouble-click action in legendDouble-click action in legendDisplay classification attribute in layer titlesDisplay classification attribute in layer titlesMinimum line / stroke width in millimeters.Minimum line / stroke width in millimeters.ZoomingZoomingSpecifies the change in zoom level with each move of the mouse wheel.
The bigger the number, the faster zooming with the mouse wheel will be.Specifies the change in zoom level with each move of the mouse wheel.
The bigger the number, the faster zooming with the mouse wheel will be.Remove selected scaleRemove selected scalePaste colorsPaste colorsAdd colorAdd colorRemove colorRemove colorCopy colorsCopy colorsDefault map appearance (overridden by project properties)Default map appearance (overridden by project properties)Selection colorSelection colorOpen layer styling dockOpen layer styling dockHighlight colorHighlight color<html><head/><body><p>The color used to highlight identified feature. The alpha channel is only used for polygons fill, lines and outlines are fully opaque.</p></body></html><html><head/><body><p>The color used to highlight identified feature. The alpha channel is only used for polygons fill, lines and outlines are fully opaque.</p></body></html>BufferBufferLines / outlines buffer in millimeters.Lines / outlines buffer in millimeters.Minimum widthMinimum widthIf unchecked large numbers will be converted from m. to km. and from ft. to milesIf unchecked large numbers will be converted from m. to km. and from ft. to milesReset to default scalesReset to default scalesDefault Z valueDefault Z valueEnable snapping by defaultEnable snapping by defaultDisplay main dialog as (restart required)Display main dialog as (restart required)Snapping marker colorSnapping marker colorShow snapping tooltipsShow snapping tooltipsGrid colorGrid colorGrid and guide defaultsGrid and guide defaultsGrid spacingGrid spacing px pxPath(s) to search for extra print templatesPath(s) to search for extra print templatesSuppress attribute form pop-up after feature creationSuppress attribute form pop-up after feature creationFill colorFill colorPro&mpt for CRSPro&mpt for CRSUse pro&ject CRSUse pro&ject CRSDefault expiration period for WMS capabilities (hours)Default expiration period for WMS capabilities (hours)Max retry in case of tile or feature request errorsMax retry in case of tile or feature request errorsClear cacheClear cache<html><head/><body><p>The connection cache stores all authentication connections data even when the connection fails.<br/>If you make any change to the authentication configurations or to the certification authorities, you should clear the authentication cache or<br/>restart QGIS. <br/>When this option is checked, the authentication cache will be automatically cleared every time an SSL error occurs and you choose to abort the connection.<br/></p></body></html><html><head/><body><p>The connection cache stores all authentication connections data even when the connection fails.<br/>If you make any change to the authentication configurations or to the certification authorities, you should clear the authentication cache or<br/>restart QGIS. <br/>When this option is checked, the authentication cache will be automatically cleared every time an SSL error occurs and you choose to abort the connection.<br/></p></body></html>Automatically clear the connection authentication cache on SSL errors (recommended)Automatically clear the connection authentication cache on SSL errors (recommended)Clear authentication connection cacheClear authentication connection cacheUse pro&xy for web accessUse pro&xy for web accessRemove selected URLRemove selected URLAdd URL to excludeAdd URL to excludeExpression VariablesExpression VariablesLocator FiltersLocator FiltersAdvanced Settings EditorAdvanced Settings EditorI will be careful, I promise!I will be careful, I promise!Background colorBackground colorIgnore shapefile encoding declarationIgnore shapefile encoding declarationDisable OGR on-the-fly conversion from declared encoding to UTF-8Disable OGR on-the-fly conversion from declared encoding to UTF-8Execute expressions on server-side if possibleExecute expressions on server-side if possible<b>Note:</b> Feature simplification may speed up rendering but can result in rendering inconsistencies<b>Note:</b> Feature simplification may speed up rendering but can result in rendering inconsistenciesHigher values result in more simplificationHigher values result in more simplificationSimplify on provider side if possibleSimplify on provider side if possibleExport colorsExport colorsImport colors from fileImport colors from fileLayer legendLayer legendOpen layer propertiesOpen layer propertiesOpen attribute tableOpen attribute tableWMS getLegendGraphic ResolutionWMS getLegendGraphic ResolutionIdentifyIdentifySearch radius for identifying features and displaying map tipsSearch radius for identifying features and displaying map tipsMeasure toolMeasure toolPreferred distance unitsPreferred distance unitsRubberband colorRubberband colorPreferred angle unitsPreferred angle unitsMap update intervalMap update interval ms msDecimal placesDecimal placesKeep base unitKeep base unitZoom factorZoom factorPredefined scalesPredefined scalesAdd predefined scaleAdd predefined scaleImport from fileImport from fileExport to fileExport to fileDefault fontDefault fontGrid appearanceGrid appearanceGrid styleGrid style mm mmGrid offsetGrid offsetx: x: y: y: Snap toleranceSnap toleranceFeature creationFeature creationValidate geometriesValidate geometriesReuse last entered attribute valuesReuse last entered attribute valuesRubberbandRubberbandLine colorLine colorLine width in pixelsLine width in pixelsLine widthLine widthSnappingSnappingDefault snap modeDefault snap modeDefault snapping toleranceDefault snapping toleranceSearch radius for vertex editsSearch radius for vertex editsmap unitsmap unitspixelspixelsPreferred area unitsPreferred area unitsVertex markersVertex markersMarker styleMarker styleMarker sizeMarker sizeShow markers only for selected featuresShow markers only for selected featuresCurve offset toolCurve offset toolMiter limitMiter limitJoin styleJoin styleQuadrant segmentsQuadrant segmentsGDAL driver optionsGDAL driver optionsEdit Pyramids OptionsEdit Pyramids OptionsEdit Create OptionsEdit Create OptionsGDAL driversGDAL driversIn some cases more than one GDAL driver can be used to load the same raster format. Use the list below to specify which to use.In some cases more than one GDAL driver can be used to load the same raster format. Use the list below to specify which to use.NameNameextextFlagsFlagsDescriptionDescriptionCRS for new layersCRS for new layersWhen a new layer is created, or when a layer is loaded that has no CRSWhen a new layer is created, or when a layer is loaded that has no CRSDefault CRS for new projectsDefault CRS for new projectsDefault datum transformationsDefault datum transformationsWMS search addressWMS search addressTimeout for network requests (ms)Timeout for network requests (ms)Default expiration period for WMS-C/WMTS tiles (hours)Default expiration period for WMS-C/WMTS tiles (hours)User-AgentUser-AgentCache settingsCache settingsContentContentDirectoryDirectorySize [KiB]Size [KiB]HostHostPortPortProxy typeProxy typeExclude URLs (starting with)Exclude URLs (starting with)Default uses system's proxyDefault uses system's proxyQgsOptionsDialogBaseMissing ObjectsMissing ObjectsBase options dialog could not be initialized.
Missing some of the .ui template objects:
Base options dialog could not be initialized.
Missing some of the .ui template objects:
QgsOracleColumnTypeThreadRetrieving tables of %1…Retrieving tables of %1…Scanning column %1.%2.%3…Scanning column %1.%2.%3…Table retrieval finished.Table retrieval finished.QgsOracleConnConnection to database failedConnection to database failedOracleOracleCould not switch to workspace %1 [%2]Could not switch to workspace %1 [%2]Database connection was successful, but the accessible tables could not be determined.Database connection was successful, but the accessible tables could not be determined.Unable to get list of spatially enabled tables from the databaseUnable to get list of spatially enabled tables from the databaseUnsupported geometry type %1 in %2.%3.%4 ignoredUnsupported geometry type %1 in %2.%3.%4 ignoredView %1.%2 doesn't have integer columns for use as keys.View %1.%2 doesn't have integer columns for use as keys.Connection failed %1s ago - skipping retryConnection failed %1s ago - skipping retrySQL: %1 [owner: %2 table_name: %3]
error: %4
SQL: %1 [owner: %2 table_name: %3]
error: %4
Querying available tables failed.
SQL: %1
error: %2
Querying available tables failed.
SQL: %1
error: %2
SQL: %1
error: %2
SQL: %1
error: %2
PointPointMultipointMultipointLineLineMultilineMultilinePolygonPolygonMultipolygonMultipolygonNo GeometryNo GeometryUnknown GeometryUnknown GeometryQgsOracleConnectionItemRefreshRefreshScanning tables for %1Scanning tables for %1Edit Connection…Edit Connection…Delete ConnectionDelete Connection%1: Not a valid layer!%1: Not a valid layer!%1: Not a vector layer!%1: Not a vector layer!Import to Oracle databaseImport to Oracle databaseFailed to import some layers!
Failed to import some layers!
Import was successful.Import was successful.QgsOracleLayerItemDelete TableDelete TableTable deleted successfully.Table deleted successfully.QgsOracleNewConnectionSaving PasswordsSaving PasswordsWARNING: You have opted to save your password. It will be stored in plain text in your project files and in your home directory on Unix-like systems, or in your user profile on Windows. If you do not want this to happen, please press the Cancel button.
WARNING: You have opted to save your password. It will be stored in plain text in your project files and in your home directory on Unix-like systems, or in your user profile on Windows. If you do not want this to happen, please press the Cancel button.
Save ConnectionSave ConnectionConnection to %1 was successful.Connection to %1 was successful.Connection failed - consult message log for details.Connection failed - consult message log for details.Should the existing connection %1 be overwritten?Should the existing connection %1 be overwritten?QgsOracleNewConnectionBaseConnection InformationConnection InformationPasswordPasswordUsernameUsernameName of the new connectionName of the new connectionSave passwordSave passwordOnly look in metadata tableOnly look in metadata tableDatabaseDatabaseSchemaSchemaIf specified, only tables from the matching schema will be fetched and listed for the providerIf specified, only tables from the matching schema will be fetched and listed for the providerCreate a New Oracle ConnectionCreate a New Oracle ConnectionNameNameRestrict the displayed tables to those that are in the all_sdo_geom_metadata tableRestrict the displayed tables to those that are in the all_sdo_geom_metadata tableSave usernameSave usernameWhen searching for spatial tables restrict the search to tables that are owned by the user.When searching for spatial tables restrict the search to tables that are owned by the user.<html><head/><body><p>When searching for spatial tables restrict the search to tables that are owned by the user.</p></body></html><html><head/><body><p>When searching for spatial tables restrict the search to tables that are owned by the user.</p></body></html>Only list the existing geometry types and don't offer to add others.Only list the existing geometry types and don't offer to add others.Only existing geometry typesOnly existing geometry typesWorkspaceWorkspaceInclude additional geometry attributesInclude additional geometry attributes<html><head/><body><p>Restricts the displayed tables to those that are in the all_sdo_geom_metadata view. This can speed up the initial display of spatial tables.</p></body></html><html><head/><body><p>Restricts the displayed tables to those that are in the all_sdo_geom_metadata view. This can speed up the initial display of spatial tables.</p></body></html>Only look for user's tablesOnly look for user's tablesAlso list tables with no geometryAlso list tables with no geometryPortPort15211521&Test Connect&Test ConnectHostHostUse estimated table statistics for the layer metadata.Use estimated table statistics for the layer metadata.<html><head/><body><p>When the layer is setup various metadata is required for the Oracle table. This includes information such as the table row count, geometry type and spatial extents of the data in the geometry column. If the table contains a large number of rows determining this metadata is time consuming.</p><p>By activating this option the following fast table metadata operations are done:</p><p>1) Row count is determined from all_tables.num_rows.</p><p>2) Table extents are always determined with the SDO_TUNE.EXTENTS_OF function even if a layer filter is applied.</p><p>3) The table geometry is determined from the first 100 non-null geometry rows in the table.</p></body></html><html><head/><body><p>When the layer is setup various metadata is required for the Oracle table. This includes information such as the table row count, geometry type and spatial extents of the data in the geometry column. If the table contains a large number of rows determining this metadata is time consuming.</p><p>By activating this option the following fast table metadata operations are done:</p><p>1) Row count is determined from all_tables.num_rows.</p><p>2) Table extents are always determined with the SDO_TUNE.EXTENTS_OF function even if a layer filter is applied.</p><p>3) The table geometry is determined from the first 100 non-null geometry rows in the table.</p></body></html>Use estimated table metadataUse estimated table metadataOptionsOptionsQgsOracleOwnerItem%1 as %2 in %3%1 as %2 in %3as geometryless tableas geometryless tableQgsOracleProviderWhole numberWhole numberWhole big numberWhole big numberDecimal number (numeric)Decimal number (numeric)Decimal number (decimal)Decimal number (decimal)Decimal number (real)Decimal number (real)Decimal number (double)Decimal number (double)Text, fixed length (char)Text, fixed length (char)Text, limited variable length (varchar2)Text, limited variable length (varchar2)Text, unlimited length (long)Text, unlimited length (long)DateDateDate & TimeDate & TimeFAILURE: Field %1 not found.FAILURE: Field %1 not found.OracleOracleRead attempt on an invalid oracle data sourceRead attempt on an invalid oracle data sourceLoading comment for table %1.%2 failed [%3]Loading comment for table %1.%2 failed [%3]Loading comment for columns of table %1.%2 failed [%3]Loading comment for columns of table %1.%2 failed [%3]Loading field types for table %1.%2 failed [%3]Loading field types for table %1.%2 failed [%3]Invalid spatial index %1 on column %2.%3.%4 found - expect poor performance.Invalid spatial index %1 on column %2.%3.%4 found - expect poor performance.Probing for spatial index on column %1.%2.%3 failed [%4]Probing for spatial index on column %1.%2.%3 failed [%4]Retrieving fields from '%1' failed [%2]Retrieving fields from '%1' failed [%2]Unable to determine geometry column access privileges for column %1.%2.
The error message from the database was:
%3.
SQL: %4Unable to determine geometry column access privileges for column %1.%2.
The error message from the database was:
%3.
SQL: %4Unable to determine table access privileges for the table %1.
The error message from the database was:
%2.
SQL: %3Unable to determine table access privileges for the table %1.
The error message from the database was:
%2.
SQL: %3The custom query is not a select query.The custom query is not a select query.Unable to execute the query.
The error message from the database was:
%1.
SQL: %2Unable to execute the query.
The error message from the database was:
%1.
SQL: %2Primary key field %1 not found in %2Primary key field %1 not found in %2Primary key field '%1' for view not unique.Primary key field '%1' for view not unique.Key field '%1' for view not found.Key field '%1' for view not found.No key field for view given.No key field for view given.No key field for query given.No key field for query given.Evaluation of default value failedEvaluation of default value failedRetrieval of updated primary keys from versioned tables not supportedRetrieval of updated primary keys from versioned tables not supportedCould not start transactionCould not start transactionCould not prepare get feature id statementCould not prepare get feature id statementCould not prepare insert statementCould not prepare insert statementCould not insert feature %1Could not insert feature %1Could not retrieve feature id %1Could not retrieve feature id %1Could not commit transactionCould not commit transactionOracle error while adding features: %1Oracle error while adding features: %1Could not rollback transactionCould not rollback transactionDeletion of feature %1 failedDeletion of feature %1 failedOracle error while deleting features: %1Oracle error while deleting features: %1Adding attribute %1 failedAdding attribute %1 failedSetting comment on %1 failedSetting comment on %1 failedOracle error while adding attributes: %1Oracle error while adding attributes: %1Could not reload fields.Could not reload fields.Dropping column %1 failedDropping column %1 failedOracle error while deleting attributes: %1Oracle error while deleting attributes: %1Invalid attribute index: %1Invalid attribute index: %1Error renaming field %1: name '%2' already existsError renaming field %1: name '%2' already existsRenaming column %1 to %2 failedRenaming column %1 to %2 failedOracle error while renaming attributes: %1Oracle error while renaming attributes: %1Update of feature %1 failedUpdate of feature %1 failedOracle error while changing attributes: %1Oracle error while changing attributes: %1Could not update metadata for %1.%2.
SQL: %3
Error: %4Could not update metadata for %1.%2.
SQL: %3
Error: %4Could not insert metadata for %1.%2.
SQL: %3
Error: %4Could not insert metadata for %1.%2.
SQL: %3
Error: %4Creation spatial index failed.
SQL: %1
Error: %2Creation spatial index failed.
SQL: %1
Error: %2Rebuild of spatial index failed.
SQL: %1
Error: %2Rebuild of spatial index failed.
SQL: %1
Error: %2Drop created table %1 failed.
SQL: %2
Error: %3Drop created table %1 failed.
SQL: %2
Error: %3Lookup of Oracle SRID %1 failed.
SQL: %2
Error: %3Lookup of Oracle SRID %1 failed.
SQL: %2
Error: %3Could not prepare update statement.Could not prepare update statement.No spatial index on column %1.%2.%3 found - expect poor performance.No spatial index on column %1.%2.%3 found - expect poor performance. {1 ?} {1.%2.%3 ?}Oracle error while changing geometry values: %1Oracle error while changing geometry values: %1Could not retrieve extents: %1
SQL: %2Could not retrieve extents: %1
SQL: %2Could not execute query.
The error message from the database was:
%1.
SQL: %2Could not execute query.
The error message from the database was:
%1.
SQL: %2Could not retrieve SRID of %1.
The error message from the database was:
%2.
SQL: %3Could not retrieve SRID of %1.
The error message from the database was:
%2.
SQL: %3Could not determine SRID of %1.
The error message from the database was:
%2.
SQL: %3Could not determine SRID of %1.
The error message from the database was:
%2.
SQL: %3%1 has no valid geometry types.
SQL: %2%1 has no valid geometry types.
SQL: %2Could not determine geometry type of %1.
The error message from the database was:
%2.
SQL: %3Could not determine geometry type of %1.
The error message from the database was:
%2.
SQL: %3Geometry type and srid for empty column %1 of %2 undefined.Geometry type and srid for empty column %1 of %2 undefined.Feature type or srid for %1 of %2 could not be determined or was not requested.Feature type or srid for %1 of %2 could not be determined or was not requested.Editing and adding disabled for 2D+ layer (%1; %2)Editing and adding disabled for 2D+ layer (%1; %2)Could not determine table existence.Could not determine table existence.Table %1 could not be dropped.Table %1 could not be dropped.Table %1 already exists.Table %1 already exists.Table creation failed.Table creation failed.Could not lookup authid %1:%2Could not lookup authid %1:%2Could not lookup WKT.Could not lookup WKT.Could not determine new srid.Could not determine new srid.CRS not found and could not be created.CRS not found and could not be created.Could not insert metadata.Could not insert metadata.Oracle SRID %1 not found.Oracle SRID %1 not found.Oracle error: %1
SQL: %2
Error: %3Oracle error: %1
SQL: %2
Error: %3Oracle error: %1
Error: %2Oracle error: %1
Error: %2QgsOracleRootItemNew Connection…New Connection…QgsOracleSourceSelectAdd Oracle Table(s)Add Oracle Table(s)&Set Filter&Set FilterSet FilterSet FilterWildcardWildcardRegExpRegExpAllAllOwnerOwnerTableTableTypeTypeGeometry columnGeometry columnPrimary key columnPrimary key columnSRIDSRIDSqlSqlAre you sure you want to remove the %1 connection and all associated settings?Are you sure you want to remove the %1 connection and all associated settings?Confirm DeleteConfirm DeleteLoad ConnectionsLoad ConnectionsXML files (*.xml *.XML)XML files (*.xml *.XML)Select TableSelect TableYou must select a table in order to add a layer.You must select a table in order to add a layer.Scanning tables for %1Scanning tables for %1StopStopConnectConnectQgsOracleSourceSelectDelegateSelect…Select…Enter…Enter…QgsOracleTableModelOwnerOwnerTableTableTypeTypeGeometry columnGeometry columnSRIDSRIDPrimary key columnPrimary key columnSelect at idSelect at idSqlSqlSpecify a geometry typeSpecify a geometry typeEnter a SRIDEnter a SRIDSelect a primary keySelect a primary keySelect…Select…Enter…Enter…Disable 'Fast Access to Features at ID' capability to force keeping the attribute table in memory (e.g. in case of expensive views).Disable 'Fast Access to Features at ID' capability to force keeping the attribute table in memory (e.g. in case of expensive views).QgsOrderByDialogAscendingAscendingDescendingDescendingNULLs lastNULLs lastNULLs firstNULLs firstQgsOrganizeTableColumnsDialog[Action Widget][Action Widget]Organize Table columnsOrganize Table columnsSelect AllSelect AllDeselect AllDeselect AllQgsPGConnectionItemRefreshRefreshDelete ConnectionDelete ConnectionEdit Connection…Edit Connection…Create Schema…Create Schema…Create SchemaCreate SchemaSchema name:Schema name:Unable to create schema.Unable to create schema.Unable to create schema %1
%2Unable to create schema %1
%2%1: %2%1: %2%1: Not a valid layer!%1: Not a valid layer!Import to PostGIS databaseImport to PostGIS databaseFailed to import some layers!
Failed to import some layers!
Import was successful.Import was successful.Connection failedConnection failedFailed to get schemasFailed to get schemasQgsPGLayerItemViewViewTableTableRename %1…Rename %1…Delete %1Delete %1Truncate %1Truncate %1Refresh Materialized ViewRefresh Materialized ViewDelete TableDelete TableTable deleted successfully.Table deleted successfully.viewviewtabletable%1 %2.%3%1 %2.%3Rename %1Rename %1Unable to rename %1.Unable to rename %1.Unable to rename %1 %2
%3Unable to rename %1 %2
%3Truncate TableTruncate TableUnable to truncate table.Unable to truncate table.Unable to truncate %1
%2Unable to truncate %1
%2Table truncated successfully.Table truncated successfully.Refresh ViewRefresh ViewUnable to refresh the view.Unable to refresh the view.Unable to refresh view %1
%2Unable to refresh view %1
%2Materialized view refreshed successfully.Materialized view refreshed successfully.QgsPGRootItemNew Connection…New Connection…QgsPGSchemaItemas geometryless tableas geometryless tableConnection failedConnection failedFailed to get layersFailed to get layersRefreshRefreshRename Schema…Rename Schema…Delete SchemaDelete SchemaUnable to delete schema.Unable to delete schema.Schema deleted successfully.Schema deleted successfully.schema '%1'schema '%1'Rename SchemaRename SchemaUnable to rename schema.Unable to rename schema.Unable to rename schema %1
%2Unable to rename schema %1
%2Schema renamed successfully.Schema renamed successfully.ViewViewMaterialized viewMaterialized viewTableTable
%1 as %2 in %3
%1 as %2 in %3QgsPalettedRendererModelValueValueColorColorLabelLabelQgsPalettedRendererWidgetOptionsOptionsChange labelChange labelChange Color…Change Color…Change Opacity…Change Opacity…Change Label…Change Label…Advanced OptionsAdvanced OptionsLoad Classes from LayerLoad Classes from LayerLoad Color Map from File…Load Color Map from File…Export Color Map to File…Export Color Map to File…Load Color Table from FileLoad Color Table from FileLoad Color TableLoad Color TableSave Color Table as FileSave Color Table as FileDelete ClassificationDelete ClassificationSelect ColorSelect ColorOpacityOpacityChange color opacity [%]Change color opacity [%]LabelLabelCould not interpret file as a raster color table.Could not interpret file as a raster color table.Text (*.clr)Text (*.clr)Write access denied. Adjust the file permissions and try again.
Write access denied. Adjust the file permissions and try again.
Calculating…Calculating…The classification band was changed from %1 to %2.
Should the existing classes be deleted?The classification band was changed from %1 to %2.
Should the existing classes be deleted?ClassifyClassifyQgsPalettedRendererWidgetBaseFormFormAdds all missing unique values from the rasterAdds all missing unique values from the rasterClassifyClassifyAdd values manuallyAdd values manuallyRemove selected row(s)Remove selected row(s)Delete AllDelete AllAdvanced optionsAdvanced options……CancelCancelBandBandColor rampColor rampQgsPasswordLineEditHide textHide textShow textShow textQgsPasteTransformationsBasePaste TransformationsPaste Transformations<b>Note: This function is not useful yet!</b><b>Note: This function is not useful yet!</b>SourceSourceDestinationDestinationQgsPenCapStyleComboBoxSquareSquareFlatFlatRoundRoundQgsPenJoinStyleComboBoxBevelBevelMiterMiterRoundRoundQgsPenStyleComboBoxSolid LineSolid LineNo PenNo PenDash LineDash LineDot LineDot LineDash Dot LineDash Dot LineDash Dot Dot LineDash Dot Dot LineQgsPgNewConnectiondisabledisableallowallowpreferpreferrequirerequireverify-caverify-caverify-fullverify-fullSaving PasswordsSaving PasswordsWARNING: You have opted to save your password. It will be stored in unsecured plain text in your project files and in your home directory (Unix-like OS) or user profile (Windows). If you want to avoid this, press Cancel and either:
a) Don't save a password in the connection settings — it will be requested interactively when needed;
b) Use the Configuration tab to add your credentials in an HTTP Basic Authentication method and store them in an encrypted database.WARNING: You have opted to save your password. It will be stored in unsecured plain text in your project files and in your home directory (Unix-like OS) or user profile (Windows). If you want to avoid this, press Cancel and either:
a) Don't save a password in the connection settings — it will be requested interactively when needed;
b) Use the Configuration tab to add your credentials in an HTTP Basic Authentication method and store them in an encrypted database.Save ConnectionSave ConnectionConnection to %1 was successful.Connection to %1 was successful.Connection failed - consult message log for details.Connection failed - consult message log for details.Should the existing connection %1 be overwritten?Should the existing connection %1 be overwritten?QgsPgNewConnectionBaseConnection InformationConnection InformationAuthenticationAuthenticationServiceServicePortPortName of the new connectionName of the new connection54325432Restrict the displayed tables to those that are in the layer registries.Restrict the displayed tables to those that are in the layer registries.Restricts the displayed tables to those that are found in the layer registries (geometry_columns, geography_columns, topology.layer). This can speed up the initial display of spatial tables.Restricts the displayed tables to those that are found in the layer registries (geometry_columns, geography_columns, topology.layer). This can speed up the initial display of spatial tables.Only show layers in the layer registriesOnly show layers in the layer registries&Test Connection&Test ConnectionCreate a New PostGIS ConnectionCreate a New PostGIS Connection&Name&NameHos&tHos&t&Database&DatabaseSSL &modeSSL &modeRestrict the search to the public schema for spatial tables not in the geometry_columns tableRestrict the search to the public schema for spatial tables not in the geometry_columns tableWhen searching for spatial tables that are not in the geometry_columns tables, restrict the search to tables that are in the public schema (for some databases this can save lots of time)When searching for spatial tables that are not in the geometry_columns tables, restrict the search to tables that are in the public schema (for some databases this can save lots of time)Only look in the 'public' schemaOnly look in the 'public' schemaUse estimated table statistics for the layer metadata.Use estimated table statistics for the layer metadata.<html>
<body>
<p>When the layer is setup various metadata is required for the PostGIS table. This includes information such as the table row count, geometry type and spatial extents of the data in the geometry column. If the table contains a large number of rows determining this metadata is time consuming.</p>
<p>By activating this option the following fast table metadata operations are done:</p>
<p>1) Row count is determined from results of running the PostgreSQL Analyze function on the table.</p>
<p>2) Table extents are always determined with the estimated_extent PostGIS function even if a layer filter is applied.</p>
<p>3) If the table geometry type is unknown and is not exclusively taken from the geometry_columns table, then it is determined from the first 100 non-null geometry rows in the table.</p>
</body>
</html><html>
<body>
<p>When the layer is setup various metadata is required for the PostGIS table. This includes information such as the table row count, geometry type and spatial extents of the data in the geometry column. If the table contains a large number of rows determining this metadata is time consuming.</p>
<p>By activating this option the following fast table metadata operations are done:</p>
<p>1) Row count is determined from results of running the PostgreSQL Analyze function on the table.</p>
<p>2) Table extents are always determined with the estimated_extent PostGIS function even if a layer filter is applied.</p>
<p>3) If the table geometry type is unknown and is not exclusively taken from the geometry_columns table, then it is determined from the first 100 non-null geometry rows in the table.</p>
</body>
</html>Allow saving/loading QGIS projects in the databaseAllow saving/loading QGIS projects in the databaseUse estimated table metadataUse estimated table metadataAlso list tables with no geometryAlso list tables with no geometryDon't resolve type of unrestricted columns (GEOMETRY)Don't resolve type of unrestricted columns (GEOMETRY)QgsPgSourceSelectAdd PostGIS Table(s)Add PostGIS Table(s)&Set Filter&Set FilterSet FilterSet FilterWildcardWildcardRegExpRegExpAllAllSchemaSchemaTableTableCommentCommentTypeTypeGeometry columnGeometry columnFeature idFeature idSRIDSRIDSqlSqlAre you sure you want to remove the %1 connection and all associated settings?Are you sure you want to remove the %1 connection and all associated settings?Confirm DeleteConfirm DeleteLoad ConnectionsLoad ConnectionsXML files (*.xml *.XML)XML files (*.xml *.XML)Select TableSelect TableYou must select a table in order to add a layer.You must select a table in order to add a layer.Scanning tables for %1Scanning tables for %1StopStopConnectConnectQgsPgSourceSelectDelegateSelect…Select…Enter…Enter…QgsPgTableModelSchemaSchemaTableTableCommentCommentColumnColumnData TypeData TypeSpatial TypeSpatial TypeSRIDSRIDFeature idFeature idSpecify a geometry type in the '%1' columnSpecify a geometry type in the '%1' columnEnter a SRID into the '%1' columnEnter a SRID into the '%1' columnSelect columns in the '%1' column that uniquely identify features of this layerSelect columns in the '%1' column that uniquely identify features of this layerSelect at idSelect at idSqlSqlSelect…Select…Enter…Enter…Disable 'Fast Access to Features at ID' capability to force keeping the attribute table in memory (e.g. in case of expensive views).Disable 'Fast Access to Features at ID' capability to force keeping the attribute table in memory (e.g. in case of expensive views).QgsPluginInstallerThere is a new plugin availableThere is a new plugin availableThere is a plugin update availableThere is a plugin update availableQGIS Python Plugin InstallerQGIS Python Plugin InstallerServer response is 200 OK, but doesn't contain plugin metatada. This is most likely caused by a proxy or a wrong repository URL. You can configure proxy settings in QGIS options.Server response is 200 OK, but doesn't contain plugin metatada. This is most likely caused by a proxy or a wrong repository URL. You can configure proxy settings in QGIS options.Status code:Status code:Missing metadata fileMissing metadata fileError reading metadataError reading metadataUninstall (recommended)Uninstall (recommended)I will uninstall it laterI will uninstall it laterObsolete plugin:Obsolete plugin:QGIS has detected an obsolete plugin that masks its more recent version shipped with this copy of QGIS. This is likely due to files associated with a previous installation of QGIS. Do you want to remove the old plugin right now and unmask the more recent version?QGIS has detected an obsolete plugin that masks its more recent version shipped with this copy of QGIS. This is likely due to files associated with a previous installation of QGIS. Do you want to remove the old plugin right now and unmask the more recent version?Error reading repository:Error reading repository:Are you sure you want to downgrade the plugin to the latest available version? The installed one is newer!Are you sure you want to downgrade the plugin to the latest available version? The installed one is newer!Plugin installation failedPlugin installation failedPlugin has disappearedPlugin has disappearedThe plugin seems to have been installed but I don't know where. Probably the plugin package contained a wrong named directory.
Please search the list of installed plugins. I'm nearly sure you'll find the plugin there, but I just can't determine which of them it is. It also means that I won't be able to determine if this plugin is installed and inform you about available updates. However the plugin may work. Please contact the plugin author and submit this issue.The plugin seems to have been installed but I don't know where. Probably the plugin package contained a wrong named directory.
Please search the list of installed plugins. I'm nearly sure you'll find the plugin there, but I just can't determine which of them it is. It also means that I won't be able to determine if this plugin is installed and inform you about available updates. However the plugin may work. Please contact the plugin author and submit this issue.Plugin installed successfullyPlugin installed successfullyPlugin reinstalled successfullyPlugin reinstalled successfullyPython plugin reinstalled.
You need to restart QGIS in order to reload it.Python plugin reinstalled.
You need to restart QGIS in order to reload it.The plugin is not compatible with this version of QGIS. It's designed for QGIS versions:The plugin is not compatible with this version of QGIS. It's designed for QGIS versions:The plugin depends on some components missing on your system. You need to install the following Python module in order to enable it:The plugin depends on some components missing on your system. You need to install the following Python module in order to enable it:The plugin is broken. Python said:The plugin is broken. Python said:Plugin uninstall failedPlugin uninstall failedAre you sure you want to uninstall the following plugin?Are you sure you want to uninstall the following plugin?Warning: this plugin isn't available in any accessible repository!Warning: this plugin isn't available in any accessible repository!Plugin uninstalled successfullyPlugin uninstalled successfullyUnable to add another repository with the same URL!Unable to add another repository with the same URL!This repository is blocked due to incompatibility with your QGIS versionThis repository is blocked due to incompatibility with your QGIS versionYou can't remove the official QGIS Plugin Repository. You can disable it if needed.You can't remove the official QGIS Plugin Repository. You can disable it if needed.Are you sure you want to remove the following repository?Are you sure you want to remove the following repository?Aborted by userAborted by userWrong password. Please enter a correct password to the zip file.Wrong password. Please enter a correct password to the zip file.The zip file is encrypted. Please enter password.The zip file is encrypted. Please enter password.Enter passwordEnter passwordFailed to unzip the plugin package
{}.
Probably it is brokenFailed to unzip the plugin package
{}.
Probably it is brokenUpdate of network request with authentication credentials FAILED for configuration '{0}'Update of network request with authentication credentials FAILED for configuration '{0}'If you haven't canceled the download manually, it was most likely caused by a timeout. In this case consider increasing the connection timeout value in QGIS options window.If you haven't canceled the download manually, it was most likely caused by a timeout. In this case consider increasing the connection timeout value in QGIS options window.Too many redirectionsToo many redirectionsMissing __init__.pyMissing __init__.pyIf you haven't canceled the download manually, it might be caused by a timeout. In this case consider increasing the connection timeout value in QGIS options.If you haven't canceled the download manually, it might be caused by a timeout. In this case consider increasing the connection timeout value in QGIS options.QGIS Official Plugin RepositoryQGIS Official Plugin RepositoryNothing to remove! Plugin directory doesn't exist:Nothing to remove! Plugin directory doesn't exist:Failed to remove the directory:Failed to remove the directory:Check permissions or remove it manuallyCheck permissions or remove it manuallyQgsPluginInstallerFetchingDialogSuccessSuccessResolving host name…Resolving host name…Connecting…Connecting…Host connected. Sending request…Host connected. Sending request…Downloading data…Downloading data…Closing connection…Closing connection…QgsPluginInstallerFetchingDialogBaseFetching repositoriesFetching repositoriesOverall progressOverall progressAbort FetchingAbort FetchingRepositoryRepositoryStateStateQgsPluginInstallerInstallingDialogUpdate of network request with authentication credentials FAILED for configuration '{0}'Update of network request with authentication credentials FAILED for configuration '{0}'Installing…Installing…Resolving host name…Resolving host name…Connecting…Connecting…Host connected. Sending request…Host connected. Sending request…Downloading data…Downloading data…Closing connection…Closing connection…Failed to unzip the plugin package. Probably it's broken or missing from the repository. You may also want to make sure that you have write permission to the plugin directory:Failed to unzip the plugin package. Probably it's broken or missing from the repository. You may also want to make sure that you have write permission to the plugin directory:Aborted by userAborted by userQgsPluginInstallerInstallingDialogBaseQGIS Python Plugin InstallerQGIS Python Plugin InstallerInstalling plugin:Installing plugin:Connecting...Connecting...QgsPluginInstallerPluginErrorDialogno error message receivedno error message receivedQgsPluginInstallerPluginErrorDialogBaseError loading pluginError loading pluginThe plugin seems to be invalid or have unfulfilled dependencies. It has been installed, but can't be loaded. If you really need this plugin, you can contact its author or <a href="http://lists.osgeo.org/mailman/listinfo/qgis-user">QGIS users group</a> and try to solve the problem. If not, you can just uninstall it. Here is the error message below:The plugin seems to be invalid or have unfulfilled dependencies. It has been installed, but can't be loaded. If you really need this plugin, you can contact its author or <a href="http://lists.osgeo.org/mailman/listinfo/qgis-user">QGIS users group</a> and try to solve the problem. If not, you can just uninstall it. Here is the error message below:Do you want to uninstall this plugin now? If you're unsure, probably you would like to do this.Do you want to uninstall this plugin now? If you're unsure, probably you would like to do this.QgsPluginInstallerRepositoryDetailsDialogBaseRepository detailsRepository detailsEnter a name for the repositoryEnter a name for the repositoryNameNameEnter the repository URL, beginning with "http://" or "file:///"Enter the repository URL, beginning with "http://" or "file:///"AuthenticationAuthenticationClearClearEditEditEnable or disable the repository (disabled repositories will be omitted)Enable or disable the repository (disabled repositories will be omitted)ParametersParameters?qgis=?qgis=URLURLEnabledEnabledQgsPluginManagerPluginsPluginsPlugin packages (*.zip *.ZIP)Plugin packages (*.zip *.ZIP)No PluginsNo PluginsNo QGIS plugins found in %1No QGIS plugins found in %1Only locally availablecategory: plugins that are only locally availableOnly locally availableReinstallablecategory: plugins that are installed and availableReinstallableUpgradeablecategory: plugins that are installed and there is a newer version availableUpgradeableDowngradeablecategory: plugins that are installed and there is an OLDER version availableDowngradeableInstallablecategory: plugins that are available for installationInstallableThis plugin is incompatible with this version of QGISThis plugin is incompatible with this version of QGISPlugin designed for QGIS %1compatible QGIS version(s)Plugin designed for QGIS %1This plugin requires a missing moduleThis plugin requires a missing moduleThis plugin is brokenThis plugin is brokenThere is a new version availableThere is a new version availableThis is a new pluginThis is a new pluginInstalled version of this plugin is higher than any version found in repositoryInstalled version of this plugin is higher than any version found in repositoryThis plugin is experimentalThis plugin is experimentalThis plugin is deprecatedThis plugin is deprecatedbug trackerbug trackercode repositorycode repositoryInstalled versionInstalled versionAvailable versionAvailable versionChangelogChangelogReload all RepositoriesReload all RepositoriesOnly Show Plugins from Selected RepositoryOnly Show Plugins from Selected RepositoryClear FilterClear FilterSecurity warning: installing a plugin from an untrusted source can lead to data loss and/or leak. Continue?Security warning: installing a plugin from an untrusted source can lead to data loss and/or leak. Continue?Don't show this again.Don't show this again.Average rating %1Average rating %1CategoryCategoryTagsTagsAuthorAuthorMore infoMore infoSearch…Search…Sort by NameSort by NameSort by DownloadsSort by DownloadsSort by VoteSort by VoteSort by StatusSort by StatusThis is a core plugin, so you can't uninstall itThis is a core plugin, so you can't uninstall it%1 rating vote(s)%1 rating vote(s)%1 downloads%1 downloadshomepagehomepageUpgrade pluginUpgrade pluginDowngrade pluginDowngrade pluginInstall pluginInstall pluginReinstall pluginReinstall pluginconnectedconnectedThe repository is connectedThe repository is connectedunavailableunavailableThe repository is enabled, but unavailableThe repository is enabled, but unavailabledisableddisabledThe repository is disabledThe repository is disabledThe repository is blocked due to incompatibility with your QGIS versionThe repository is blocked due to incompatibility with your QGIS versionVote sent successfullyVote sent successfullySending vote to the plugin repository failed.Sending vote to the plugin repository failed.<h3>Upgradable plugins</h3><p>Here are <b>upgradeable plugins</b>. It means more recent versions of installed plugins are available in the repositories.</p><h3>Upgradable plugins</h3><p>Here are <b>upgradeable plugins</b>. It means more recent versions of installed plugins are available in the repositories.</p><h3>All Plugins</h3><p>On the left you see the list of all plugins available for your QGIS, both installed and available for download. Some plugins come with your QGIS installation while most of them are made available via the plugin repositories.</p><p>You can temporarily enable or disable a plugin. To <i>enable</i> or <i>disable</i> a plugin, click its checkbox or double-click its name...</p><p>Plugins showing in <span style='color:red'>red</span> are not loaded because there is a problem. They are also listed on the 'Invalid' tab. Click on the plugin name to see more details, or to reinstall or uninstall this plugin.</p><h3>All Plugins</h3><p>On the left you see the list of all plugins available for your QGIS, both installed and available for download. Some plugins come with your QGIS installation while most of them are made available via the plugin repositories.</p><p>You can temporarily enable or disable a plugin. To <i>enable</i> or <i>disable</i> a plugin, click its checkbox or double-click its name...</p><p>Plugins showing in <span style='color:red'>red</span> are not loaded because there is a problem. They are also listed on the 'Invalid' tab. Click on the plugin name to see more details, or to reinstall or uninstall this plugin.</p><h3>Installed Plugins</h3><p>Here you only see plugins <b>installed on your QGIS</b>.</p><p>Click on the name to see details. </p><p>Click the checkbox or double-click the name to <i>activate</i> or <i>deactivate</i> the plugin.</p><p>You can change the sorting via the context menu (right click).</p><h3>Installed Plugins</h3><p>Here you only see plugins <b>installed on your QGIS</b>.</p><p>Click on the name to see details. </p><p>Click the checkbox or double-click the name to <i>activate</i> or <i>deactivate</i> the plugin.</p><p>You can change the sorting via the context menu (right click).</p><h3>Not installed plugins</h3><p>Here you see the list of all plugins available in the repositories, but which are <b>not yet installed</b>.</p><p>Click on the name to see details.</p><p>You can change the sorting via the context menu (right click).</p><p>A plugin can be downloaded and installed by clicking on it's name, and then click the 'Install plugin' button.</p><h3>Not installed plugins</h3><p>Here you see the list of all plugins available in the repositories, but which are <b>not yet installed</b>.</p><p>Click on the name to see details.</p><p>You can change the sorting via the context menu (right click).</p><p>A plugin can be downloaded and installed by clicking on it's name, and then click the 'Install plugin' button.</p><h3>New plugins</h3><p>Here you see brand <b>new</b> plugins which can be installed.</p><h3>New plugins</h3><p>Here you see brand <b>new</b> plugins which can be installed.</p><h3>Invalid plugins</h3><p>Plugins in this list here are <b>broken or incompatible</b> with your version of QGIS.</p><p>Click on an individual plugin; if possible QGIS shows you more information.</p><p>The main reasons to have invalid plugins is that this plugin is not build for this version of QGIS. Maybe you can download another version from <a href="http://plugins.qgis.org">plugins.qgis.org</a>.</p><p>Another common reason is that a python plugin needs some external python libraries (dependencies). You can install them yourself, depending on your operating system. After a correct install the plugin should work.</p><h3>Invalid plugins</h3><p>Plugins in this list here are <b>broken or incompatible</b> with your version of QGIS.</p><p>Click on an individual plugin; if possible QGIS shows you more information.</p><p>The main reasons to have invalid plugins is that this plugin is not build for this version of QGIS. Maybe you can download another version from <a href="http://plugins.qgis.org">plugins.qgis.org</a>.</p><p>Another common reason is that a python plugin needs some external python libraries (dependencies). You can install them yourself, depending on your operating system. After a correct install the plugin should work.</p>QgsPluginManagerBasePlugin ManagerPlugin ManagerAllAllInstalledInstalledInstalled pluginsInstalled pluginsNot installed plugins available for downloadNot installed plugins available for downloadUpgradeableUpgradeableInstalled plugins with more recent version available for downloadInstalled plugins with more recent version available for downloadNewNewNot installed plugins seen for the first timeNot installed plugins seen for the first timeInvalidInvalidBroken and incompatible installed pluginsBroken and incompatible installed pluginsSettingsSettingsNot installedNot installedInstall from ZIPInstall from ZIPabout:blankabout:blankVote!Vote!Your VoteYour VoteCurrent voteCurrent voteUpgrade all upgradeable pluginsUpgrade all upgradeable pluginsUninstall the selected pluginUninstall the selected pluginInstall, reinstall or upgrade the selected pluginInstall, reinstall or upgrade the selected pluginUpgrade AllUpgrade AllUninstall PluginUninstall PluginReinstall PluginReinstall Plugin<html><head/><body><p>If you are provided with a zip package containing a plugin to install, please select the file below and click the <span style=" font-style:italic;">Install plugin</span> button.</p><p>Please note for most users this function is not applicable, as the preferable way is to install plugins from a repository.</p></body></html><html><head/><body><p>If you are provided with a zip package containing a plugin to install, please select the file below and click the <span style=" font-style:italic;">Install plugin</span> button.</p><p>Please note for most users this function is not applicable, as the preferable way is to install plugins from a repository.</p></body></html>ZIP file:ZIP file:Install PluginInstall PluginThe settings on this tab are only applicable for Python Plugins. No Python support detected, thus no settings available.The settings on this tab are only applicable for Python Plugins. No Python support detected, thus no settings available.Check for updates on startupCheck for updates on startupevery time QGIS startsevery time QGIS startsonce a dayonce a dayevery 3 daysevery 3 daysevery weekevery weekevery 2 weeksevery 2 weeksevery monthevery month<!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.0//EN" "http://www.w3.org/TR/REC-html40/strict.dtd">
<html><head><meta name="qrichtext" content="1" /><style type="text/css">
p, li { white-space: pre-wrap; }
</style></head><body style=" font-family:'DejaVu Sans'; font-size:9pt; font-weight:400; font-style:normal;">
<p style=" margin-top:0px; margin-bottom:0px; margin-left:0px; margin-right:0px; -qt-block-indent:0; text-indent:0px;"><span style=" font-weight:600;">Note:</span> If this function is enabled, QGIS will inform you whenever a new plugin or plugin update is available. Otherwise, fetching repositories will be performed during opening of the Plugin Manager window.</p></body></html><!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.0//EN" "http://www.w3.org/TR/REC-html40/strict.dtd">
<html><head><meta name="qrichtext" content="1" /><style type="text/css">
p, li { white-space: pre-wrap; }
</style></head><body style=" font-family:'DejaVu Sans'; font-size:9pt; font-weight:400; font-style:normal;">
<p style=" margin-top:0px; margin-bottom:0px; margin-left:0px; margin-right:0px; -qt-block-indent:0; text-indent:0px;"><span style=" font-weight:600;">Note:</span> If this function is enabled, QGIS will inform you whenever a new plugin or plugin update is available. Otherwise, fetching repositories will be performed during opening of the Plugin Manager window.</p></body></html>Show also experimental pluginsShow also experimental plugins<!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.0//EN" "http://www.w3.org/TR/REC-html40/strict.dtd">
<html><head><meta name="qrichtext" content="1" /><style type="text/css">
p, li { white-space: pre-wrap; }
</style></head><body style=" font-family:'DejaVu Sans'; font-size:9pt; font-weight:400; font-style:normal;">
<p style=" margin-top:0px; margin-bottom:0px; margin-left:0px; margin-right:0px; -qt-block-indent:0; text-indent:0px;"><span style=" font-weight:600;">Note:</span> Experimental plugins are generally unsuitable for production use. These plugins are in early stages of development, and should be considered 'incomplete' or 'proof of concept' tools. QGIS does not recommend installing these plugins unless you intend to use them for testing purposes.</p></body></html><!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.0//EN" "http://www.w3.org/TR/REC-html40/strict.dtd">
<html><head><meta name="qrichtext" content="1" /><style type="text/css">
p, li { white-space: pre-wrap; }
</style></head><body style=" font-family:'DejaVu Sans'; font-size:9pt; font-weight:400; font-style:normal;">
<p style=" margin-top:0px; margin-bottom:0px; margin-left:0px; margin-right:0px; -qt-block-indent:0; text-indent:0px;"><span style=" font-weight:600;">Note:</span> Experimental plugins are generally unsuitable for production use. These plugins are in early stages of development, and should be considered 'incomplete' or 'proof of concept' tools. QGIS does not recommend installing these plugins unless you intend to use them for testing purposes.</p></body></html>Show also deprecated pluginsShow also deprecated plugins<!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.0//EN" "http://www.w3.org/TR/REC-html40/strict.dtd">
<html><head><meta name="qrichtext" content="1" /><style type="text/css">
p, li { white-space: pre-wrap; }
</style></head><body style=" font-family:'Droid Sans'; font-size:10pt; font-weight:400; font-style:normal;">
<p style=" margin-top:0px; margin-bottom:0px; margin-left:0px; margin-right:0px; -qt-block-indent:0; text-indent:0px;"><span style=" font-family:'DejaVu Sans'; font-size:9pt; font-weight:600;">Note:</span><span style=" font-family:'DejaVu Sans'; font-size:9pt;"> Deprecated plugins are generally unsuitable for production use. These plugins are unmaintained, and should be considered 'obsolete' tools. QGIS does not recommend installing these plugins unless you still need it and there are no other alternatives available.</span></p></body></html><!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.0//EN" "http://www.w3.org/TR/REC-html40/strict.dtd">
<html><head><meta name="qrichtext" content="1" /><style type="text/css">
p, li { white-space: pre-wrap; }
</style></head><body style=" font-family:'Droid Sans'; font-size:10pt; font-weight:400; font-style:normal;">
<p style=" margin-top:0px; margin-bottom:0px; margin-left:0px; margin-right:0px; -qt-block-indent:0; text-indent:0px;"><span style=" font-family:'DejaVu Sans'; font-size:9pt; font-weight:600;">Note:</span><span style=" font-family:'DejaVu Sans'; font-size:9pt;"> Deprecated plugins are generally unsuitable for production use. These plugins are unmaintained, and should be considered 'obsolete' tools. QGIS does not recommend installing these plugins unless you still need it and there are no other alternatives available.</span></p></body></html>Plugin repositoriesPlugin repositoriesStatusStatusNameNameURLURLReload repository contents
(useful when you uploaded a plugin there)Reload repository contents
(useful when you uploaded a plugin there)Reload RepositoryReload RepositoryConfigure an additional plugin repositoryConfigure an additional plugin repositoryAdd a new plugin repositoryAdd a new plugin repositoryAdd...Add...Edit the selected repositoryEdit the selected repositoryEdit...Edit...Remove the selected repositoryRemove the selected repositoryDeleteDeleteQgsPoint3DSymbolWidgetSphereSphereCylinderCylinderCubeCubeConeConePlanePlaneTorusTorus3D Model3D ModelOpen 3d Model FileOpen 3d Model FileInvalid FileInvalid FileError, file does not exist or is not readable.Error, file does not exist or is not readable.QgsPointClusterRendererWidgetCluster symbolCluster symbolRenderer SettingsRenderer SettingsThe point cluster renderer only applies to (single) point layers.
'%1' is not a (single) point layer and cannot be displayed by the point cluster renderer.The point cluster renderer only applies to (single) point layers.
'%1' is not a (single) point layer and cannot be displayed by the point cluster renderer.QgsPointClusterRendererWidgetBaseFormFormDistanceDistanceRenderer Settings...Renderer Settings...RendererRendererCluster symbolCluster symbolQgsPointDisplacementRendererWidgetRingRingConcentric ringsConcentric ringsGridGridNoneNoneSelect ColorSelect ColorTransparent StrokeTransparent StrokeCenter symbolCenter symbolRenderer SettingsRenderer SettingsThe point displacement renderer only applies to (single) point layers.
'%1' is not a (single) point layer and cannot be displayed by the point displacement renderer.The point displacement renderer only applies to (single) point layers.
'%1' is not a (single) point layer and cannot be displayed by the point displacement renderer.QgsPointDisplacementRendererWidgetBaseFormFormLabel attributeLabel attributeLabel fontLabel fontLabel colorLabel colorUse scale dependent labelingUse scale dependent labelingMinimum map scaleMinimum map scaleFontFontRenderer Settings...Renderer Settings...Displacement LinesDisplacement LinesSize adjustmentSize adjustmentStroke widthStroke widthStroke colorStroke colorCenter symbolCenter symbol mm mmRendererRendererPoint distance tolerancePoint distance tolerancePlacement methodPlacement methodDistanceDistanceLabelsLabelsQgsPostgresConnConnection to database failedConnection to database failedPostGISPostGISerror in setting encodingerror in setting encodingundefined return value from encoding settingundefined return value from encoding settingYour PostGIS installation has no GEOS support. Feature selection and identification will not work properly. Please install PostGIS with GEOS support (http://geos.refractions.net)Your PostGIS installation has no GEOS support. Feature selection and identification will not work properly. Please install PostGIS with GEOS support (http://geos.refractions.net)Database connection was successful, but the accessible tables could not be determined.Database connection was successful, but the accessible tables could not be determined.Database connection was successful, but the accessible tables could not be determined. The error message from the database was:
%1
Database connection was successful, but the accessible tables could not be determined. The error message from the database was:
%1
Cannot set WriteOwner permission to cert: %0 to allow removing itCannot set WriteOwner permission to cert: %0 to allow removing itClient security failureClient security failureCannot remove cert: %0Cannot remove cert: %0SQL: %1
result: %2
error: %3
SQL: %1
result: %2
error: %3
Unsupported spatial column type %1Unsupported spatial column type %1Database connection was successful, but the accessible tables could not be determined.
The error message from the database was:
%1Database connection was successful, but the accessible tables could not be determined.
The error message from the database was:
%1Unable to get list of spatially enabled tables from the databaseUnable to get list of spatially enabled tables from the databaseNo PostGIS support in the database.No PostGIS support in the database.Could not parse postgis version string '%1'Could not parse postgis version string '%1'Connection error: %1 returned %2 [%3]Connection error: %1 returned %2 [%3]Erroneous query: %1 returned %2 [%3]Erroneous query: %1 returned %2 [%3]Query failed: %1
Error: no result bufferQuery failed: %1
Error: no result bufferQuery: %1 returned %2 [%3]Query: %1 returned %2 [%3]%1 cursor states lost.
SQL: %2
Result: %3 (%4)%1 cursor states lost.
SQL: %2
Result: %3 (%4)resetting bad connection.resetting bad connection.retry after reset succeeded.retry after reset succeeded.retry after reset failed again.retry after reset failed again.connection still bad after reset.connection still bad after reset.bad connection, not retrying.bad connection, not retrying.NoneNoneGeometryGeometryGeographyGeographyTopoGeometryTopoGeometryPcPatchPcPatchQuery could not be canceled [%1]Query could not be canceled [%1]PQgetCancel failedPQgetCancel failedQgsPostgresProjectStorageDialogConnectionConnectionSchemaSchemaProjectProjectStorage of QGIS projects is not enabled for this database connection.Storage of QGIS projects is not enabled for this database connection.Manage ProjectsManage ProjectsRemove ProjectRemove ProjectSave project to PostgreSQLSave project to PostgreSQLLoad project from PostgreSQLLoad project from PostgreSQLErrorErrorConnection failedConnection failedFailed to get schemasFailed to get schemasOverwrite projectOverwrite projectA project with the same name already exists. Would you like to overwrite it?A project with the same name already exists. Would you like to overwrite it?Remove projectRemove projectDo you really want to remove the project "%1"?Do you really want to remove the project "%1"?QgsPostgresProviderinvalid PostgreSQL layerinvalid PostgreSQL layerPostGISPostGISinvalid PostgreSQL topology layerinvalid PostgreSQL topology layerPostgreSQL layer has no primary key.PostgreSQL layer has no primary key.Whole number (smallint - 16bit)Whole number (smallint - 16bit)Whole number (integer - 32bit)Whole number (integer - 32bit)Whole number (integer - 64bit)Whole number (integer - 64bit)Decimal number (numeric)Decimal number (numeric)Decimal number (decimal)Decimal number (decimal)Decimal number (real)Decimal number (real)Decimal number (double)Decimal number (double)Text, fixed length (char)Text, fixed length (char)Text, limited variable length (varchar)Text, limited variable length (varchar)Text, unlimited length (text)Text, unlimited length (text)DateDateTimeTimeDate & TimeDate & TimeArray of number (integer - 32bit)Array of number (integer - 32bit)Array of number (integer - 64bit)Array of number (integer - 64bit)Array of number (double)Array of number (double)Array of textArray of textBooleanBooleanPostgreSQL layer has unknown primary key type.PostgreSQL layer has unknown primary key type.FAILURE: Field %1 not found.FAILURE: Field %1 not found.unexpected formatted field type '%1' for field %2unexpected formatted field type '%1' for field %2Field %1 ignored, because of unsupported type %2Field %1 ignored, because of unsupported type %2Duplicate field %1 found
Duplicate field %1 found
Unable to access the %1 relation.
The error message from the database was:
%2.
SQL: %3Unable to access the %1 relation.
The error message from the database was:
%2.
SQL: %3PostgreSQL is still in recovery after a database crash
(or you are connected to a (read-only) slave).
Write accesses will be denied.PostgreSQL is still in recovery after a database crash
(or you are connected to a (read-only) slave).
Write accesses will be denied.Unable to determine table access privileges for the %1 relation.
The error message from the database was:
%2.
SQL: %3Unable to determine table access privileges for the %1 relation.
The error message from the database was:
%2.
SQL: %3The custom query is not a select query.The custom query is not a select query.Unable to execute the query.
The error message from the database was:
%1.
SQL: %2Unable to execute the query.
The error message from the database was:
%1.
SQL: %2The table has no column suitable for use as a key. QGIS requires a primary key, a PostgreSQL oid column or a ctid for tables.The table has no column suitable for use as a key. QGIS requires a primary key, a PostgreSQL oid column or a ctid for tables.Unique column '%1' doesn't have a NOT NULL constraint.Unique column '%1' doesn't have a NOT NULL constraint.Key field '%1' for view/query not found.Key field '%1' for view/query not found.Primary key field '%1' for view/query not unique.Primary key field '%1' for view/query not unique.Keys for view/query undefined.Keys for view/query undefined.No key field for view/query given.No key field for view/query given.Unexpected relation type '%1'.Unexpected relation type '%1'.Map (hstore)Map (hstore)Map (json)Map (json)Map (jsonb)Map (jsonb)Read attempt on an invalid PostgreSQL data sourceRead attempt on an invalid PostgreSQL data sourceCannot parse widget configuration for field %1.%2.%3
Cannot parse widget configuration for field %1.%2.%3
Ignoring key candidate because of NULL values or inheritanceIgnoring key candidate because of NULL values or inheritanceCould not execute queryCould not execute queryCould not find topology of layer %1.%2.%3Could not find topology of layer %1.%2.%3PostGIS error while adding features: %1PostGIS error while adding features: %1PostGIS error while deleting features: %1PostGIS error while deleting features: %1PostGIS error while truncating: %1PostGIS error while truncating: %1PostGIS error while adding attributes: %1PostGIS error while adding attributes: %1PostGIS error while deleting attributes: %1PostGIS error while deleting attributes: %1Invalid attribute index: %1Invalid attribute index: %1Error renaming field %1: name '%2' already existsError renaming field %1: name '%2' already existsPostGIS error while renaming attributes: %1PostGIS error while renaming attributes: %1PostGIS error while changing attributes: %1PostGIS error while changing attributes: %1PostGIS error while changing geometry values: %1PostGIS error while changing geometry values: %1result of extents query invalid: %1result of extents query invalid: %1Geometry type and srid for empty column %1 of %2 undefined.Geometry type and srid for empty column %1 of %2 undefined.Feature type or srid for %1 of %2 could not be determined or was not requested.Feature type or srid for %1 of %2 could not be determined or was not requested.PostgreSQL version: unknownPostgreSQL version: unknownunknownunknownPostgreSQL not connectedPostgreSQL not connectedPostgreSQL/PostGIS provider
%1
PostGIS %2PostgreSQL/PostGIS provider
%1
PostGIS %2Primary key is ctid - changing of existing features disabled (%1; %2)Primary key is ctid - changing of existing features disabled (%1; %2)QgsPresetColorRampDialogColor Presets RampColor Presets RampQgsPresetColorRampWidgetSelect ColorSelect ColorQgsPresetColorRampWidgetBaseColor Presets RampColor Presets RampAdd colorAdd colorRemove colorRemove colorCopy colorsCopy colorsPaste colorsPaste colorsImport colorsImport colorsExport colorsExport colorsPreviewPreviewQgsProcessingAlgRunnerTaskExecuting “%1”Executing “%1”QgsProcessingAlgorithmDialogBaseRunRunText filesText filesHTML filesHTML filesSave Log to FileSave Log to FileQgsProcessingBooleanWidgetWrapperYesYesNoNoQgsProcessingCrsWidgetWrapperUse project CRSUse project CRSAlways use the current project CRS when running the modelAlways use the current project CRS when running the modelstring as EPSG code, WKT or PROJ format, or a string identifying a map layerstring as EPSG code, WKT or PROJ format, or a string identifying a map layerQgsProcessingDialogBaseDialogDialogParametersParametersLogLogSave Log to FileSave Log to File......Copy Log to ClipboardCopy Log to ClipboardClear LogClear LogCancelCancelQgsProcessingDistanceWidgetWrapperDistance is in geographic degrees. Consider reprojecting to a projected local coordinate system for accurate results.Distance is in geographic degrees. Consider reprojecting to a projected local coordinate system for accurate results.QgsProcessingFeedbackProcessingProcessingQgsProcessingModelerParameterWidgetUsing model inputUsing model inputUsing algorithm outputUsing algorithm outputValueValuePre-calculated ValuePre-calculated ValueModel InputModel InputAlgorithm OutputAlgorithm Output“%1” from algorithm “%2”“%1” from algorithm “%2”QgsProcessingNumericWidgetWrapperNot setNot setQgsProcessingProgressDialogBaseDialogDialogQgsProcessingProviderDuplicate algorithm name %1 for provider %2Duplicate algorithm name %1 for provider %2QgsProcessingRangeWidgetWrapperMinMinMaxMaxstring as two comma delimited floats, e.g. '1,10'string as two comma delimited floats, e.g. '1,10'QgsProcessingToolboxModelRecently usedRecently usedQgsProjectLoading layer %1Loading layer %1Unable to open %1Unable to open %1%1 at line %2 column %3%1 at line %2 column %3%1 for file %2%1 for file %2Project Variables InvalidProject Variables InvalidThe project contains invalid variable settings.The project contains invalid variable settings.Translated project saved with locale prefix %1Translated project saved with locale prefix %1Error saving translated project with locale prefix %1Error saving translated project with locale prefix %1Unable to read file %1Unable to read file %1Unable to save project to storage %1Unable to save project to storage %1Unable to create backup file %1Unable to create backup file %1Unable to save to file %1Unable to save to file %1Unable to unzip file '%1'Unable to unzip file '%1'Zip archive does not provide a project fileZip archive does not provide a project fileCannot read unzipped qgs project fileCannot read unzipped qgs project fileUnable to write temporary qgs fileUnable to write temporary qgs fileUnable to perform zipUnable to perform zip%1 is not writable. Please adjust permissions (if possible) and try again.%1 is not writable. Please adjust permissions (if possible) and try again.Read Project FileRead Project FileProject file read error in file %1: %2 at line %3 column %4Project file read error in file %1: %2 at line %3 column %4Unable to save auxiliary storage ('%1')Unable to save auxiliary storage ('%1')Unable to save to file %1. Your project may be corrupted on disk. Try clearing some space on the volume and check file permissions before pressing save again.Unable to save to file %1. Your project may be corrupted on disk. Try clearing some space on the volume and check file permissions before pressing save again.QgsProjectHomeItemSet Project Home…Set Project Home…Select Project Home DirectorySelect Project Home DirectoryQgsProjectLayerGroupDialogQGIS filesQGIS filesSelect Project FileSelect Project FileEmbed Layers and GroupsEmbed Layers and GroupsRecursive embedding is not supported. It is not possible to embed layers / groups from the current project.Recursive embedding is not supported. It is not possible to embed layers / groups from the current project.QgsProjectLayerGroupDialogBaseSelect Layers and Groups to EmbedSelect Layers and Groups to EmbedProject fileProject fileQgsProjectPropertiesCoordinate System RestrictionCoordinate System RestrictionNo coordinate systems selected. Disabling restriction.No coordinate systems selected. Disabling restriction.Decimal degreesDecimal degreesDegrees, minutesDegrees, minutesDegrees, minutes, secondsDegrees, minutes, secondsMetersMetersFeetFeetNautical milesNautical milesDegreesDegreesMap unitsMap unitsKilometersKilometersYardsYardsMilesMilesSquare metersSquare metersSquare kilometersSquare kilometersSquare feetSquare feetSquare yardsSquare yardsSquare milesSquare milesHectaresHectaresAcresAcresSquare nautical milesSquare nautical milesSquare degreesSquare degreesLayers are in edit mode. Stop edit mode on all layers to toggle transactional editing.Layers are in edit mode. Stop edit mode on all layers to toggle transactional editing.Select Project Home PathSelect Project Home PathSelection ColorSelection ColorFilter layers…Filter layers…CustodianCustodianOwnerOwnerUserUserDistributorDistributorOriginatorOriginatorPoint of contactPoint of contactPrincipal investigatorPrincipal investigatorProcessorProcessorPublisherPublisherAuthorAuthorConditions unknownConditions unknownNo conditions applyNo conditions applyNoneNoneCopyrightCopyrightPatentPatentPatent pendingPatent pendingTrademarkTrademarkLicenseLicenseIntellectual property rightsIntellectual property rightsRestrictedRestrictedOther restrictionsOther restrictionsUnknown unitsUnknown unitsMap units (%1)Map units (%1)CRS %1 was already selectedCRS %1 was already selectedCoordinate System RestrictionsCoordinate System RestrictionsThe current selection of coordinate systems will be lost.
Proceed?The current selection of coordinate systems will be lost.
Proceed?Select layoutSelect layoutLayout TitleLayout TitleSet ScaleSet ScaleGeneral TS file generatedGeneral TS file generatedTS file generated with source language %1.
- open it with Qt Linguist
- translate strings
- save it with the postfix of the target language (eg. de)
- release to get qm file including postfix (eg. aproject_de.qm)
When you open it again in QGIS having set the target language (de), the project will be translated and saved with postfix (eg. aproject_de.qgs).TS file generated with source language %1.
- open it with Qt Linguist
- translate strings
- save it with the postfix of the target language (eg. de)
- release to get qm file including postfix (eg. aproject_de.qm)
When you open it again in QGIS having set the target language (de), the project will be translated and saved with postfix (eg. aproject_de.qgs).Select Restricted Layers and GroupsSelect Restricted Layers and GroupsCustomCustomStart checking QGIS ServerStart checking QGIS ServerUse short name for "%1"Use short name for "%1"Some layers and groups have the same name or short nameSome layers and groups have the same name or short nameDuplicate names:Duplicate names:All names and short names of layer and group are uniqueAll names and short names of layer and group are uniqueSome layer short names have to be updated:Some layer short names have to be updated:All layer short names are well formedAll layer short names are well formedSome layer encodings are not set:Some layer encodings are not set:All layer encodings are setAll layer encodings are setEnter scaleEnter scaleScale denominatorScale denominatorLoad scalesLoad scalesXML files (*.xml *.XML)XML files (*.xml *.XML)Save scalesSave scalesSelect a valid symbolSelect a valid symbolInvalid symbol : Invalid symbol : Update layer "%1" encodingUpdate layer "%1" encodingSelect %1 from pull-down menu to adjust radiiSelect %1 from pull-down menu to adjust radiiSelect ColorSelect ColorThe text you entered is not a valid scale.The text you entered is not a valid scale.QgsProjectPropertiesBaseProject PropertiesProject PropertiesGeneralGeneralProject titleProject titleDescriptive project nameDescriptive project nameDefault project titleDefault project titleSelection colorSelection colorBackground colorBackground colorabsoluteabsoluterelativerelativeSave pathsSave pathsSemi-minorSemi-minorSemi-majorSemi-majorCRSCRSCoordinate Reference SystemCoordinate Reference SystemDefault stylesDefault stylesVariablesVariablesChecking this setting avoids visible edge artifacts when rendering this project as separate map tiles. Rendering performance will be degraded.Checking this setting avoids visible edge artifacts when rendering this project as separate map tiles. Rendering performance will be degraded.Avoid artifacts when project is rendered as map tiles (degrades performance)Avoid artifacts when project is rendered as map tiles (degrades performance)PrecisionPrecisionAutomaticAutomaticProject Predefined ScalesProject Predefined ScalesSource languageSource languageDatum TransformationsDatum TransformationsDefault SymbolsDefault SymbolsProject ColorsProject ColorsLayers CapabilitiesLayers CapabilitiesToggle SelectionToggle SelectionShow spatial layers onlyShow spatial layers onlyPython MacrosPython MacrosService CapabilitiesService CapabilitiesPositionPositionShort nameShort nameExclude layoutsExclude layoutsAdd layout to excludeAdd layout to excludeRemove selected layoutRemove selected layoutScenario 2 - INSPIRE related fields using embedded service metadataScenario 2 - INSPIRE related fields using embedded service metadataDeselect AllDeselect AllSelect AllSelect AllTest ConfigurationTest ConfigurationLaunchLaunchWhen enabled, layers from the same database connection will be put into a transaction group. Their edit state will be synchronized and changes to these layers will be sent to the provider immediately. Only supported on postgres provider.When enabled, layers from the same database connection will be put into a transaction group. Their edit state will be synchronized and changes to these layers will be sent to the provider immediately. Only supported on postgres provider.Automatically create transaction groups where possibleAutomatically create transaction groups where possibleWhen enabled, default values will be evaluated as early as possible. This will fill default values in the add feature form already and not only create them on commit. Only supported for postgres provider.When enabled, default values will be evaluated as early as possible. This will fill default values in the add feature form already and not only create them on commit. Only supported for postgres provider.Evaluate default values on provider sideEvaluate default values on provider sideExpression VariablesExpression VariablesManualManualThe number of decimal places for the manual optionThe number of decimal places for the manual optiondecimal placesdecimal placesLayerLayerMarkerMarkerLineLineFillFillColor RampColor RampStyle ManagerStyle ManagerOptionsOptionsRelationsRelationsProject fileProject fileAssign random colors to symbolsAssign random colors to symbolsCopy colorsCopy colorsAdd colorAdd colorPaste colorsPaste colorsRemove colorRemove colorThe web site URL of the service provider.The web site URL of the service provider.PersonPersonTitleTitleOrganizationOrganizationOnline resourceOnline resourceE-MailE-MailPhonePhoneAbstractAbstractFeesFeesAccess constraintsAccess constraintsKeyword listKeyword listWMS capabilitiesWMS capabilitiesAdd geometry to feature responseAdd geometry to feature responseMin. XMin. XCoordinate DisplayCoordinate DisplayMin. YMin. YMax. XMax. XMax. YMax. YUse Current Canvas ExtentUse Current Canvas ExtentUsedUsedWCS capabilitiesWCS capabilitiesExclude layersExclude layersQuality for JPEG images ( 10 : smaller image - 100 : best quality )Quality for JPEG images ( 10 : smaller image - 100 : best quality )Use layer ids as namesUse layer ids as namesData SourcesData SourcesMeasurementsMeasurementsUnits for distance measurementUnits for distance measurementUnits for area measurementUnits for area measurementDisplay coordinates usingDisplay coordinates usingAutomatically sets the number of decimal places to use when displaying coordinatesAutomatically sets the number of decimal places to use when displaying coordinatesManually set the number of decimal places to use when displaying coordinatesManually set the number of decimal places to use when displaying coordinatesImport colorsImport colorsMetadataMetadataDefault StylesDefault StylesData sourcesData sourcesQGIS ServerQGIS ServerWMS/WFS/WCS Server ConfigurationWMS/WFS/WCS Server ConfigurationGeneral SettingsGeneral SettingsProject homeProject homeOpen folder containing the projectOpen folder containing the project……Project home path. Leave blank to use the current project file location.Project home path. Leave blank to use the current project file location.Set the project home pathSet the project home pathEllipsoid
(for distance and area calculations)Ellipsoid
(for distance and area calculations)Add predefined scaleAdd predefined scaleRemove selected scaleRemove selected scaleImport from fileImport from fileSave to fileSave to fileGenerate Project Translation FileGenerate Project Translation FileGenerate TS FileGenerate TS FileProject Coordinate Reference System (CRS)Project Coordinate Reference System (CRS)Ask for datum transformation if several are available (defined in global setting)Ask for datum transformation if several are available (defined in global setting)Edit symbolEdit symbolOpacityOpacityExport colorsExport colorsSpeed up project loading by skipping data checks. Useful in qgis server context or project with huge database views or materialized views.Speed up project loading by skipping data checks. Useful in qgis server context or project with huge database views or materialized views.Trust project when data source has no metadataTrust project when data source has no metadataThe contact person e-mail for the service.The contact person e-mail for the service.The contact person name for the service.The contact person name for the service.The name of the service provider.The name of the service provider.The title should be brief yet descriptive enough to identify this service.The title should be brief yet descriptive enough to identify this service.The contact person phone for the service.The contact person phone for the service.The abstract is a descriptive narrative providing more information about the service.The abstract is a descriptive narrative providing more information about the service.List of keywords separated by comma to help catalog searching.List of keywords separated by comma to help catalog searching.Fees applied to the service.Fees applied to the service.Access constraints applied to the service.Access constraints applied to the service.The contact person position for the service.The contact person position for the service.A name used to identify the root layer. The short name is a text string used for machine-to-machine communication.A name used to identify the root layer. The short name is a text string used for machine-to-machine communication.Add layer to excludeAdd layer to excludeRemove selected layerRemove selected layerAdd new CRSAdd new CRSFetch all CRS's from layersFetch all CRS's from layersRemove selected CRSRemove selected CRSGetFeatureInfo geometry precision (decimal places)GetFeatureInfo geometry precision (decimal places)INSPIRE (European directive)INSPIRE (European directive)Service languageService languageMetadata dateMetadata dateLast revision dateLast revision dateScenario 1 - INSPIRE related fields using referenced external service metadataScenario 1 - INSPIRE related fields using referenced external service metadataMetadata URLMetadata URLapplication/vnd.iso.19139+xmlapplication/vnd.iso.19139+xmlapplication/vnd.ogc.csw.GetRecordByIdResponse_xmlapplication/vnd.ogc.csw.GetRecordByIdResponse_xmlapplication/vnd.ogc.csw_xmlapplication/vnd.ogc.csw_xmlURL mime/typeURL mime/typeSegmentize feature info geometrySegmentize feature info geometryAllow defining datasources in server requestsAllow defining datasources in server requestsWMTS capabilitiesWMTS capabilitiesPNGPNGJPEGJPEGMinimum scaleMinimum scaleWFS capabilities (also influences DXF export)WFS capabilities (also influences DXF export)PublishedPublishedGeometry precision (decimal places)Geometry precision (decimal places)UpdateUpdateInsertInsertDeleteDeleteMacrosMacrosAdvertised URLAdvertised URLWidthWidthHeightHeightMaximums for GetMap requestMaximums for GetMap requestAdvertised extentAdvertised extentCRS restrictionsCRS restrictionsQgsProjectSnappingSettingsCannot read individual settings. Unexpected tag '%1'Cannot read individual settings. Unexpected tag '%1'QgsProjectionSelectionDialogDefine this layer's coordinate reference system:Define this layer's coordinate reference system:This layer appears to have no projection specification.This layer appears to have no projection specification.By default, this layer will now have its projection set to that of the project, but you may override this by selecting a different projection below.By default, this layer will now have its projection set to that of the project, but you may override this by selecting a different projection below.QgsProjectionSelectionTreeWidgetResource Location ErrorResource Location ErrorError reading database file from:
%1
Because of this the projection selector will not work…Error reading database file from:
%1
Because of this the projection selector will not work…User Defined Coordinate SystemsUser Defined Coordinate SystemsGeographic Coordinate SystemsGeographic Coordinate SystemsProjected Coordinate SystemsProjected Coordinate SystemsExtent: %1, %2, %3, %4Extent: %1, %2, %3, %4Proj4: %1Proj4: %1Extent: Extent not knownExtent: Extent not knownQgsProjectionSelectionWidgetinvalid projectioninvalid projectionSelect CRSSelect CRSLayer CRS: %1 - %2Layer CRS: %1 - %2Project CRS: %1 - %2Project CRS: %1 - %2Default CRS: %1 - %2Default CRS: %1 - %2%1 - %2%1 - %2QgsProjectionSelectionWidgetPluginA widget to select a generic projection system.A widget to select a generic projection system.QgsProjectionSelectorBaseCoordinate Reference System SelectorCoordinate Reference System SelectorSelected CRSSelected CRSFilterFilterRecently used coordinate reference systemsRecently used coordinate reference systemsUse this option to treat all coordinates as Cartesian coordinates in an unknown reference system.Use this option to treat all coordinates as Cartesian coordinates in an unknown reference system.No projection (or unknown/non-Earth projection)No projection (or unknown/non-Earth projection)Coordinate Reference SystemCoordinate Reference SystemAuthority IDAuthority IDIDIDCoordinate reference systems of the worldCoordinate reference systems of the worldHide deprecated CRSsHide deprecated CRSsQgsPropertyColorAssistantWidgetColor For Null ValuesColor For Null ValuesTransparentTransparentQgsPropertyGenericNumericAssistantWidget ° °Angle fromAngle fromAngle when NULLAngle when NULLQgsPropertyOverrideButtonVariableVariablePastePasteCopyCopyClearClearDescription…Description…Store Data in the ProjectStore Data in the ProjectEdit…Edit…Assistant…Assistant…booleanbooleanintintdoubledoublestringstringField type: Field type: integerintegerinteger64integer64unknown typeunknown typeData defined overrideData defined overrideexpressionexpressionfieldfieldDeactivateDeactivateActivateActivateAttribute FieldAttribute FieldNo matching field types foundNo matching field types foundExpressionExpressionNo variables setNo variables setCurrent: Current: Data Definition DescriptionData Definition DescriptionundefinedundefinedParse error: %1Parse error: %1'%1' field missing'%1' field missing<b><u>Data defined override</u></b><br><b><u>Data defined override</u></b><br><b>Active: </b>%1 <i>(ctrl|right-click toggles)</i><br><b>Active: </b>%1 <i>(ctrl|right-click toggles)</i><br>yesyesnono<b>Usage:</b><br>%1<br><b>Usage:</b><br>%1<br><b>Expected input:</b><br>%1<br><b>Expected input:</b><br>%1<br><b>Valid input types:</b><br>%1<br><b>Valid input types:</b><br>%1<br><b>Current definition %1:</b><br>%2<b>Current definition %1:</b><br>%2QgsPropertyOverrideButtonPluginA widget to define override for a corresponding propertyA widget to define override for a corresponding propertyA widget to define override for a corresponding property.A widget to define override for a corresponding property.QgsPropertySizeAssistantWidgetFlanneryFlannerySurfaceSurfaceRadiusRadiusExponentialExponentialLinearLinearQgsPuzzleWidgetQGISQGISWell done!
Now let's get back to work, shall we?Well done!
Now let's get back to work, shall we?QgsPyDataItem&Run Script&Run ScriptOpen in External &EditorOpen in External &EditorQgsQmlWidgetWrapperFailed to open temporary QML fileFailed to open temporary QML fileQgsQptDataItemNew Layout from TemplateNew Layout from TemplateQgsQueryBuilder&Test&Test&Clear&ClearSet provider filter on %1Set provider filter on %1Search…Search…Query ResultQuery ResultThe where clause returned %n row(s).returned test rowsThe where clause returned %n row(s).The where clause returned %n row(s).Error in query. The subset string could not be set.Error in query. The subset string could not be set.An error occurred when executing the query.An error occurred when executing the query.
The data provider said:
%1
The data provider said:
%1QgsQueryBuilderBaseQuery BuilderQuery BuilderDatasourceDatasourceFieldsFields<html><head><meta name="qrichtext" content="1" /><style type="text/css">
p, li { white-space: pre-wrap; }
</style></head><body style=" font-family:'Sans Serif'; font-size:9pt; font-weight:400; font-style:normal;">
<p style=" margin-top:0px; margin-bottom:0px; margin-left:0px; margin-right:0px; -qt-block-indent:0; text-indent:0px;">List of fields in this vector file</p></body></html><html><head><meta name="qrichtext" content="1" /><style type="text/css">
p, li { white-space: pre-wrap; }
</style></head><body style=" font-family:'Sans Serif'; font-size:9pt; font-weight:400; font-style:normal;">
<p style=" margin-top:0px; margin-bottom:0px; margin-left:0px; margin-right:0px; -qt-block-indent:0; text-indent:0px;">List of fields in this vector file</p></body></html>ValuesValues<html><head><meta name="qrichtext" content="1" /><style type="text/css">
p, li { white-space: pre-wrap; }
</style></head><body style=" font-family:'Sans Serif'; font-size:9pt; font-weight:400; font-style:normal;">
<p style=" margin-top:0px; margin-bottom:0px; margin-left:0px; margin-right:0px; -qt-block-indent:0; text-indent:0px;">List of values for the current field.</p></body></html><html><head><meta name="qrichtext" content="1" /><style type="text/css">
p, li { white-space: pre-wrap; }
</style></head><body style=" font-family:'Sans Serif'; font-size:9pt; font-weight:400; font-style:normal;">
<p style=" margin-top:0px; margin-bottom:0px; margin-left:0px; margin-right:0px; -qt-block-indent:0; text-indent:0px;">List of values for the current field.</p></body></html><html><head><meta name="qrichtext" content="1" /><style type="text/css">
p, li { white-space: pre-wrap; }
</style></head><body style=" font-family:'Sans Serif'; font-size:9pt; font-weight:400; font-style:normal;">
<p style=" margin-top:0px; margin-bottom:0px; margin-left:0px; margin-right:0px; -qt-block-indent:0; text-indent:0px;">Take a <span style=" font-weight:600;">sample</span> of records in the vector file</p></body></html><html><head><meta name="qrichtext" content="1" /><style type="text/css">
p, li { white-space: pre-wrap; }
</style></head><body style=" font-family:'Sans Serif'; font-size:9pt; font-weight:400; font-style:normal;">
<p style=" margin-top:0px; margin-bottom:0px; margin-left:0px; margin-right:0px; -qt-block-indent:0; text-indent:0px;">Take a <span style=" font-weight:600;">sample</span> of records in the vector file</p></body></html>SampleSample<html><head><meta name="qrichtext" content="1" /><style type="text/css">
p, li { white-space: pre-wrap; }
</style></head><body style=" font-family:'Sans Serif'; font-size:9pt; font-weight:400; font-style:normal;">
<p style=" margin-top:0px; margin-bottom:0px; margin-left:0px; margin-right:0px; -qt-block-indent:0; text-indent:0px;">Retrieve <span style=" font-weight:600;">all</span> the record in the vector file (<span style=" font-style:italic;">if the table is big, the operation can consume some time</span>)</p></body></html><html><head><meta name="qrichtext" content="1" /><style type="text/css">
p, li { white-space: pre-wrap; }
</style></head><body style=" font-family:'Sans Serif'; font-size:9pt; font-weight:400; font-style:normal;">
<p style=" margin-top:0px; margin-bottom:0px; margin-left:0px; margin-right:0px; -qt-block-indent:0; text-indent:0px;">Retrieve <span style=" font-weight:600;">all</span> the record in the vector file (<span style=" font-style:italic;">if the table is big, the operation can consume some time</span>)</p></body></html>AllAllUse unfiltered layerUse unfiltered layerOperatorsOperators==<<NOTNOTORORANDAND%%ININNOT INNOT IN!=!=>>LIKELIKEILIKEILIKE>=>=<=<=Provider specific filter expressionProvider specific filter expressionQgsQuickAttributeModelValue "%1" %4 could not be converted to a compatible value for field %2(%3).Value "%1" %4 could not be converted to a compatible value for field %2(%3).Cannot update featureCannot update featureFeature %1 could not be fetched after commitFeature %1 could not be fetched after commitCannot delete featureCannot delete featureDefault value expression for %1:%2 has parser error: %3Default value expression for %1:%2 has parser error: %3Default value expression for %1:%2 has evaluation error: %3Default value expression for %1:%2 has evaluation error: %3Feature could not be addedFeature could not be addedCould not save changes. Rolling back.Could not save changes. Rolling back.Cannot start editingCannot start editingQgsQuickMapCanvasMapRenderingRenderingQgsQuickMapSettingsMap Canvas rotation is not supported. Resetting from %1 to 0.Map Canvas rotation is not supported. Resetting from %1 to 0.QgsQuickPositionKitUnable to create default GPS Position SourceUnable to create default GPS Position SourceQgsQuickUtilsscreen resolution: %1x%2 px
screen resolution: %1x%2 px
screen DPI: %1x%2
screen DPI: %1x%2
screen size: %1x%2 mm
screen size: %1x%2 mm
screen density: %1screen density: %1QgsRangeConfigDlgEditableEditableSliderSliderDialDialCurrent minimum for this value is %1 and current maximum is %2.Current minimum for this value is %1 and current maximum is %2.Attribute has no integer or real type, therefore range is not usable.Attribute has no integer or real type, therefore range is not usable.QgsRangeConfigDlgBaseFormFormAllows setting of numeric values from a specified range. The edit widget can be either a slider or a spin box.Allows setting of numeric values from a specified range. The edit widget can be either a slider or a spin box.Advanced OptionsAdvanced OptionsStepStepSuffixSuffixInactiveInactivePrecisionPrecisionNumber of decimal placesNumber of decimal placesMaximumMaximumAllow NULLAllow NULLMinimumMinimumLocal minimum/maximum = 0/0Local minimum/maximum = 0/0QgsRasterBandComboBoxNot setNot setQgsRasterBandComboBoxPluginA combo box to list the bands from a raster layerA combo box to list the bands from a raster layerA combo box to list the bands from a raster layer.A combo box to list the bands from a raster layer.QgsRasterCalcDialogEnter result fileEnter result fileExpression validExpression validExpression invalidExpression invalidQgsRasterCalcDialogBaseOutput layerOutput layerX minX minY minY minY maxY maxColumnsColumnsRaster CalculatorRaster CalculatorRaster BandsRaster BandsResult LayerResult LayerRowsRowsOutput formatOutput formatRaster Calculator ExpressionRaster Calculator ExpressionAdd result to projectAdd result to projectOutput CRSOutput CRSOperatorsOperators!=!=++**sqrtsqrtsinsin^^acosacos((--//coscosSelected Layer ExtentSelected Layer Extentasinasintantanatanatan))<<>>==ORORANDANDX MaxX Max<=<=>=>=log10log10lnlnQgsRasterDataProviderFormat not supportedFormat not supportedValueValueTextTextHtmlHtmlFeatureFeatureQgsRasterFileWriterTaskSaving %1Saving %1QgsRasterFillSymbolLayerWidgetSelect Image FileSelect Image FileQgsRasterFormatSaveOptionsWidgetDefaultDefaultNo compressionNo compressionLow compressionLow compressionHigh compressionHigh compressionJPEG compressionJPEG compressionCannot get create options for driver %1Cannot get create options for driver %1For details on pyramids options please see the following pagesFor details on pyramids options please see the following pagesNo help availableNo help availablecannot validate pyramid optionscannot validate pyramid optionsCannot validate creation options.Cannot validate creation options.ValidValidInvalid %1:
%2
Click on help button to get valid creation options for this format.Invalid %1:
%2
Click on help button to get valid creation options for this format.pyramid creation optionpyramid creation optioncreation optioncreation optionProfile name:Profile name:Use simple interfaceUse simple interfaceUse table interfaceUse table interfaceQgsRasterFormatSaveOptionsWidgetBaseFormFormNewNewRemoveRemoveResetResetProfileProfileNameNameValueValueValidateValidateHelpHelpInsert KEY=VALUE pairs separated by spacesInsert KEY=VALUE pairs separated by spacesQgsRasterHistogramWidgetVisibilityVisibilityMin/Max optionsMin/Max optionsAlways show min/max markersAlways show min/max markersZoom to min/maxZoom to min/maxUpdate style to min/maxUpdate style to min/maxShow all bandsShow all bandsShow RGB/Gray band(s)Show RGB/Gray band(s)Show selected bandShow selected bandDisplayDisplayDraw as linesDraw as linesDraw as lines (only int layers)Draw as lines (only int layers)ActionsActionsResetResetLoad min/maxLoad min/maxEstimate (faster)Estimate (faster)Actual (slower)Actual (slower)Current extentCurrent extentUse stddev (1.0)Use stddev (1.0)Use stddev (custom)Use stddev (custom)Load for each bandLoad for each bandRecompute HistogramRecompute HistogramBand %1Band %1Choose a file name to save the map image asChoose a file name to save the map image asQgsRasterHistogramWidgetBaseFormForm……Set min/max style forSet min/max style forMinMinPick Min value on graphPick Min value on graphMaxMaxPick Max value on graphPick Max value on graphPrefs/ActionsPrefs/ActionsSave plotSave plotSave as image...Save as image...Compute HistogramCompute HistogramQgsRasterInterfaceIdentifyIdentifyBuild PyramidsBuild PyramidsCreate DatasourcesCreate DatasourcesRemove DatasourcesRemove DatasourcesBandBandQgsRasterLayerNot SetNot SetQgsRasterLayer createdQgsRasterLayer createdInformation from providerInformation from providerNameNameSourceSourcePathPathCRSCRSGeographicGeographicProjectedProjectedExtentExtentUnitUnitWidthWidthn/an/aHeightHeightData typeData typeIdentificationIdentificationAccessAccessBandsBandsBand countBand countNumberNumberNo-DataNo-DataMinMinMaxMaxContactsContactsReferencesReferencesHistoryHistoryRasterRasterCould not determine raster data type.Could not determine raster data type.Byte - Eight bit unsigned integerByte - Eight bit unsigned integerUInt16 - Sixteen bit unsigned integer UInt16 - Sixteen bit unsigned integer Int16 - Sixteen bit signed integer Int16 - Sixteen bit signed integer UInt32 - Thirty two bit unsigned integer UInt32 - Thirty two bit unsigned integer Int32 - Thirty two bit signed integer Int32 - Thirty two bit signed integer Float32 - Thirty two bit floating point Float32 - Thirty two bit floating point Float64 - Sixty four bit floating point Float64 - Sixty four bit floating point CInt16 - Complex Int16 CInt16 - Complex Int16 CInt32 - Complex Int32 CInt32 - Complex Int32 CFloat32 - Complex Float32 CFloat32 - Complex Float32 CFloat64 - Complex Float64 CFloat64 - Complex Float64 BandBandCannot instantiate the '%1' data providerCannot instantiate the '%1' data providerProvider is not valid (provider: %1, URI: %2Provider is not valid (provider: %1, URI: %2<maplayer> not found.<maplayer> not found.QgsRasterLayerPropertiesNot SetNot SetLoad Style…Load Style…Save Style…Save Style…MetadataMetadataLoad Metadata…Load Metadata…Save Metadata…Save Metadata…DescriptionDescriptionLarge resolution raster layers can slow navigation in QGIS.Large resolution raster layers can slow navigation in QGIS.By creating lower resolution copies of the data (pyramids) performance can be considerably improved as QGIS selects the most suitable resolution to use depending on the level of zoom.By creating lower resolution copies of the data (pyramids) performance can be considerably improved as QGIS selects the most suitable resolution to use depending on the level of zoom.You must have write access in the directory where the original data is stored to build pyramids.You must have write access in the directory where the original data is stored to build pyramids.Please note that building internal pyramids may alter the original data file and once created they cannot be removed!Please note that building internal pyramids may alter the original data file and once created they cannot be removed!Please note that building internal pyramids could corrupt your image - always make a backup of your data first!Please note that building internal pyramids could corrupt your image - always make a backup of your data first!Select ColorSelect ColorLayer Properties - %1Layer Properties - %1Building PyramidsBuilding PyramidsImport Transparent PixelsImport Transparent PixelsSave StyleSave StyleSave Layer Metadata as QMDSave Layer Metadata as QMDSave MetadataSave MetadataNearest neighbourNearest neighbourSave as DefaultSave as DefaultBilinearBilinearCubicCubicAverageAverageNoneNoneRedRedGreenGreenBlueBluePercent TransparentPercent TransparentGrayGrayIndexed ValueIndexed ValueFromFromToTonot definednot definedWrite access denied. Adjust the file permissions and try again.Write access denied. Adjust the file permissions and try again.The file was not writable. Some formats do not support pyramid overviews. Consult the GDAL documentation if in doubt.The file was not writable. Some formats do not support pyramid overviews. Consult the GDAL documentation if in doubt.Building pyramid overviews is not supported on this type of raster.Building pyramid overviews is not supported on this type of raster.Building internal pyramid overviews is not supported on raster layers with JPEG compression and your current libtiff library.Building internal pyramid overviews is not supported on raster layers with JPEG compression and your current libtiff library.TextfileTextfileSave FileSave FileQGIS Generated Transparent Pixel Value Export FileQGIS Generated Transparent Pixel Value Export FileValueValueWrite access denied. Adjust the file permissions and try again.
Write access denied. Adjust the file permissions and try again.
Export Transparent PixelsExport Transparent PixelsOpen fileOpen fileThe following lines contained errors
%1The following lines contained errors
%1Read access denied. Adjust the file permissions and try again.
Read access denied. Adjust the file permissions and try again.
Default StyleDefault StyleLoad layer properties from style fileLoad layer properties from style fileQGIS Layer Style FileQGIS Layer Style FileSave layer properties as style fileSave layer properties as style fileLoad layer metadata from metadata fileLoad layer metadata from metadata fileQGIS Layer Metadata FileQGIS Layer Metadata FileLoad MetadataLoad MetadataQMD FileQMD FileDefault MetadataDefault MetadataStyleStyleRestore DefaultRestore DefaultQgsRasterLayerPropertiesBaseRaster Layer PropertiesRaster Layer PropertiesResolutionsResolutionsRender typeRender typeResamplingResamplingOversamplingOversamplingTransparencyTransparencyDescriptionDescriptionKeyword listKeyword listList of keywords separated by comma to help catalog searching.List of keywords separated by comma to help catalog searching.FormatFormatData UrlData Url……Refresh layer at interval (seconds)Refresh layer at interval (seconds)Higher values result in more simplificationHigher values result in more simplificationShort nameShort nameAttributionAttributionAttribution's title indicates the provider of the layer.Attribution's title indicates the provider of the layer.UrlUrlAttribution's url gives a link to the webpage of the provider of the data layer.Attribution's url gives a link to the webpage of the provider of the data layer.MetadataUrlMetadataUrlThe URL of the metadata document.The URL of the metadata document.TypeTypeLegendUrlLegendUrlSaturationSaturationOffOffBy lightnessBy lightnessBy luminosityBy luminosityBy averageBy averageHueHueInformationInformationSourceSourceSymbologySymbologyRenderingRenderingQGIS ServerQGIS ServerEdit QGIS Server settingsEdit QGIS Server settingsSet source coordinate reference systemSet source coordinate reference systemBand RenderingBand RenderingColor RenderingColor RenderingBlending modeBlending modeBrightnessBrightnessContrastContrastGrayscaleGrayscaleColorizeColorizeStrengthStrength%%Reset all color rendering options to defaultReset all color rendering options to defaultResetResetZoomed: inZoomed: inoutoutA URL of the data presentation.A URL of the data presentation.A URL of the legend image.A URL of the legend image.WMS Print layerWMS Print layerPublish WMS/WMTS data source uriPublish WMS/WMTS data source uriAdvertise as background layerAdvertise as background layerNo data valueNo data valueUse original source no data value.Use original source no data value.Original data source no data value, if exists.Original data source no data value, if exists.<src no data value><src no data value>Additional user defined no data value.Additional user defined no data value.Additional no data valueAdditional no data valueTransparency bandTransparency bandAdd values from displayAdd values from displayTransparent pixel listTransparent pixel listThe abstract is a descriptive narrative providing more information about the layer.The abstract is a descriptive narrative providing more information about the layer.A name used to identify the layer. The short name is a text string used for machine-to-machine communication.A name used to identify the layer. The short name is a text string used for machine-to-machine communication.Embedded widgets in legendEmbedded widgets in legendAdd values manuallyAdd values manuallyRemove selected rowRemove selected rowDefault valuesDefault valuesImport from fileImport from fileExport to fileExport to fileLayer nameLayer namedisplayed asdisplayed asThumbnailThumbnailLegendLegendPalettePaletteMetadataMetadataTitleTitleThe title is for the benefit of humans to identify layer.The title is for the benefit of humans to identify layer.AbstractAbstractPyramidsPyramidsGlobal OpacityGlobal OpacityNo Data ValueNo Data ValueCustom Transparency OptionsCustom Transparency OptionsScale Dependent VisibilityScale Dependent Visibility<!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.0//EN" "http://www.w3.org/TR/REC-html40/strict.dtd">
<html><head><meta name="qrichtext" content="1" /><style type="text/css">
p, li { white-space: pre-wrap; }
</style></head><body style=" font-family:'Sans Serif'; font-size:9pt; font-weight:400; font-style:normal;">
<p style=" margin-top:0px; margin-bottom:0px; margin-left:0px; margin-right:0px; -qt-block-indent:0; text-indent:0px;"><span style=" font-family:'Cantarell'; font-size:11pt;"><br /></span></p></body></html><!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.0//EN" "http://www.w3.org/TR/REC-html40/strict.dtd">
<html><head><meta name="qrichtext" content="1" /><style type="text/css">
p, li { white-space: pre-wrap; }
</style></head><body style=" font-family:'Sans Serif'; font-size:9pt; font-weight:400; font-style:normal;">
<p style=" margin-top:0px; margin-bottom:0px; margin-left:0px; margin-right:0px; -qt-block-indent:0; text-indent:0px;"><span style=" font-family:'Cantarell'; font-size:11pt;"><br /></span></p></body></html>Build PyramidsBuild PyramidsAverageAverageNearest NeighbourNearest NeighbourResampling methodResampling methodOverview formatOverview formatExternalExternalInternal (if possible)Internal (if possible)External (Erdas Imagine)External (Erdas Imagine)HistogramHistogramQgsRasterLayerSaveAsDialogFromFromToToSelect Output DirectorySelect Output DirectorySelect output directorySelect output directoryThe layer %1 already exists in the target file, and overwriting layers in GeoPackage is not supported. Do you want to overwrite the whole file?The layer %1 already exists in the target file, and overwriting layers in GeoPackage is not supported. Do you want to overwrite the whole file?Save Layer AsSave Layer AsSave Raster LayerSave Raster LayerThe directory %1 contains files which will be overwritten: %2The directory %1 contains files which will be overwritten: %2All files (*.*)All files (*.*)layerlayeruser defineduser definedResolution (current: %1)Resolution (current: %1)QgsRasterLayerSaveAsDialogBaseOutput modeOutput modeWrite out raw raster layer data. Optionally user defined no data values may be applied.Write out raw raster layer data. Optionally user defined no data values may be applied.Raw dataRaw dataWrite out 3 bands RGB image rendered using current layer style.Write out 3 bands RGB image rendered using current layer style.Rendered imageRendered imageFormatFormatCreate GDAL Virtual Format composed of multiple
datasets with maximum width and height specified below.Create GDAL Virtual Format composed of multiple
datasets with maximum width and height specified below.Create VRTCreate VRTCRSCRSFile nameFile nameAdd saved file to mapAdd saved file to mapLayer nameLayer nameExtentExtentResolutionResolutionHorizontalHorizontalColumnsColumnsRowsRowsVerticalVerticalVRT TilesVRT TilesMaximum number of columns in one tile.Maximum number of columns in one tile.Max columnsMax columnsMaximum number of rows in one tile.Maximum number of rows in one tile.Max rowsMax rowsCreate OptionsCreate OptionsPyramidsPyramidsResolutionsResolutionsPyramid resolutions corresponding to levels givenPyramid resolutions corresponding to levels givenUse existingUse existingAdditional no data values. The specified values will be set to no data in output raster.Additional no data values. The specified values will be set to no data in output raster.No data valuesNo data valuesAdd values manuallyAdd values manuallyLoad user defined fully transparent (100%) values Load user defined fully transparent (100%) values Remove selected rowRemove selected rowSave Raster Layer as...Save Raster Layer as...Layer ResolutionLayer ResolutionLayer SizeLayer SizeClear allClear allQgsRasterMinMaxWidgetBaseFormFormMin / Max Value SettingsMin / Max Value SettingsUse&r definedUse&r definedCumula&tive
count cutCumula&tive
count cut--%%Mean +/-
standard de&viation ×Mean +/-
standard de&viation ×&Min / max&Min / maxWhole rasterWhole rasterCurrent canvasCurrent canvasUpdated canvasUpdated canvasStatistics extentStatistics extentAccuracyAccuracyActual (slower)Actual (slower)Estimate (faster)Estimate (faster)QgsRasterProjectorApproximateApproximateExactExactQgsRasterPyramidsOptionsWidgetBaseFormFormInsert positive integer values separated by spacesInsert positive integer values separated by spacesExternal (GTiff .ovr)External (GTiff .ovr)Internal (if possible)Internal (if possible)External (Erdas Imagine .aux)External (Erdas Imagine .aux)LevelsLevelsCreate OptionsCreate OptionsResampling methodResampling methodAverageAverageNearest NeighbourNearest NeighbourCustom levelsCustom levelsOverview formatOverview formatQgsRasterTransparencyWidgetFormFormNo data valueNo data valueUse original source no data value.Use original source no data value.Original data source no data value, if exists.Original data source no data value, if exists.<src no data value><src no data value>Additional user defined no data value.Additional user defined no data value.Additional no data valueAdditional no data valueNoneNoneTransparency bandTransparency bandExport to fileExport to fileGlobal OpacityGlobal OpacityNo Data ValueNo Data ValueCustom Transparency OptionsCustom Transparency OptionsTransparent Pixel ListTransparent Pixel List……Import from fileImport from fileDefault valuesDefault valuesRemove selected rowRemove selected rowAdd values from displayAdd values from displayAdd values manuallyAdd values manuallyNot SetNot Setnot definednot definedTextfileTextfileSave Pixel Values as FileSave Pixel Values as FileQGIS Generated Transparent Pixel Value Export FileQGIS Generated Transparent Pixel Value Export FileRedRedGreenGreenBlueBluePercent TransparentPercent TransparentValueValueLoad Pixel Values from FileLoad Pixel Values from FileWrite access denied. Adjust the file permissions and try again.
Write access denied. Adjust the file permissions and try again.
The following lines contained errors
%1The following lines contained errors
%1Read access denied. Adjust the file permissions and try again.
Read access denied. Adjust the file permissions and try again.
GrayGrayIndexed ValueIndexed ValueFromFromToToQgsRelReferenceConfigDlgBaseDialogDialogDisplay expressionDisplay expressionOn map identification (for geometric layers only)On map identification (for geometric layers only)Use a read-only line edit instead of a comboboxUse a read-only line edit instead of a comboboxFiltersFiltersWhen activated, the filters will restrict the choices of fields to options that are When activated, the filters will restrict the choices of fields to options that are Chain filtersChain filtersAllow adding new featuresAllow adding new featuresAllow NULL valueAllow NULL valueShow embedded formShow embedded formShow open form buttonShow open form buttonRelationRelationOrder by valueOrder by value……QgsRelationCannot create relation. Unexpected tag '%1'Cannot create relation. Unexpected tag '%1'Relation defined for layer '%1' which does not exist.Relation defined for layer '%1' which does not exist.Relation defined for layer '%1' which is not of type VectorLayer.Relation defined for layer '%1' which is not of type VectorLayer.QgsRelationAddDlg[Generated automatically][Generated automatically]QgsRelationAddDlgBaseAdd RelationAdd RelationReferenced fieldReferenced fieldReferencing layer (Child)Referencing layer (Child)Referenced layer (Parent)Referenced layer (Parent)Referencing fieldReferencing fieldRelationship strengthRelationship strengthNameNameIdIdQgsRelationAggregateSearchWidgetWrapperRelation not validRelation not validQgsRelationEditorWidgetToggle editingToggle editingToggle editing mode for child layerToggle editing mode for child layerSave child layer editsSave child layer editsAdd child featureAdd child featureDuplicate child featureDuplicate child featureDelete child featureDelete child featureLink existing featuresLink existing featuresLink existing child featuresLink existing child featuresUnlink featureUnlink featureUnlink child featureUnlink child featureZoom To FeatureZoom To FeatureZoom to child featureZoom to child featureForm viewForm viewSwitch to form viewSwitch to form viewTable viewTable viewSwitch to table viewSwitch to table viewReally delete entry?Really delete entry?The entry on %1 is still linked to %2 features on %3. Do you want to delete it?The entry on %1 is still linked to %2 features on %3. Do you want to delete it?DeleteDeleteReally delete entries?Really delete entries?The %1 entries on %2 are still linked to %3 features on %4. Do you want to delete them?The %1 entries on %2 are still linked to %3 features on %4. Do you want to delete them?Delete FeatureDelete FeatureUnlink FeatureUnlink FeatureQgsRelationEditorWidgetPluginRelation editorRelation editorQgsRelationManagerDialogBaseDialogDialogNameNameReferencing LayerReferencing LayerReferencing FieldReferencing FieldReferenced LayerReferenced LayerReferenced Layer (Parent)Referenced Layer (Parent)Referenced FieldReferenced FieldReferencing Layer (Child)Referencing Layer (Child)IdIdStrengthStrengthAdd RelationAdd RelationDiscover RelationsDiscover RelationsRemove RelationRemove RelationQgsRelationReferenceWidgetOpen related feature formOpen related feature formAdd new entryAdd new entryHighlight featureHighlight featureScale and highlight featureScale and highlight featurePan and highlight featurePan and highlight featureSelect on mapSelect on mapNo selectionNo selectionThe relation is not valid. Please make sure your relation definitions are OK.The relation is not valid. Please make sure your relation definitions are OK.%1 (no selection)%1 (no selection)Relation %1 for %2.Relation %1 for %2.Identify a feature of %1 to be associated. Press <ESC> to cancel.Identify a feature of %1 to be associated. Press <ESC> to cancel.QgsRelationReferenceWidgetPluginRelation referenceRelation referenceQgsRendererMeshPropsWidgetBaseFormFormLayer RenderingLayer RenderingBlending modeBlending modeShow ContoursShow ContoursNative Mesh RenderingNative Mesh RenderingShow VectorsShow VectorsTriangular Mesh RenderingTriangular Mesh RenderingQgsRendererPropsDialogBaseRenderer SettingsRenderer SettingsThis renderer doesn't implement a graphical interface.This renderer doesn't implement a graphical interface.Layer RenderingLayer RenderingLayerLayerFeatureFeatureOpacityOpacityControl feature rendering orderControl feature rendering order……Blending modeBlending modeQgsRendererRasterPropertiesWidgetNearest neighbourNearest neighbourBilinearBilinearCubicCubicAverageAverageSelect ColorSelect ColorQgsRendererRasterPropsWidgetBaseFormFormThis renderer doesn't implement a graphical interface.This renderer doesn't implement a graphical interface.Layer RenderingLayer RenderingBlending modeBlending modeBrightnessBrightnessSaturationSaturationContrastContrastGrayscaleGrayscaleOffOffBy lightnessBy lightnessBy luminosityBy luminosityBy averageBy averageHueHueColorizeColorizeStrengthStrength%%Reset all color rendering options to defaultReset all color rendering options to defaultResetResetResamplingResamplingZoomed inZoomed inZoomed outZoomed outOversamplingOversamplingQgsRendererRulePropsWidgetFormFormElseElseLabelLabelFilterFilterCatch-all for other featuresCatch-all for other featuresTestTestDescriptionDescriptionScale rangeScale rangeSymbolSymbolFilter expression parsing error:
Filter expression parsing error:
Test FilterTest FilterFilter returned %n feature(s)number of filtered featuresFilter returned %n feature(s)Filter returned %n feature(s)QgsRendererWidgetRenderer OptionsRenderer OptionsCopyCopyPastePasteChange Color…Change Color…Change Opacity…Change Opacity…Change Output Unit…Change Output Unit…Change Width…Change Width…Change Size…Change Size…Change Angle…Change Angle…OpacityOpacityChange symbol opacity [%]Change symbol opacity [%]Symbol unitSymbol unitSelect symbol unitSelect symbol unitMillimeterMillimeterMap unitMap unitSymbol LevelsSymbol LevelsData-defined Size LegendData-defined Size LegendData-defined size is not enabled!Data-defined size is not enabled!QgsRendererWidgetContainerBaseFormFormGo backGo backQgsReportLayoutSectionWidgetBody: %1Body: %1QgsReportOrganizerBaseLayout ManagerLayout ManagerAdd sectionAdd sectionRemove selected sectionRemove selected sectionQgsReportOrganizerWidgetReportReportA static layout report section which consists of a single layout inserted into the reportA static layout report section which consists of a single layout inserted into the reportStatic Layout SectionStatic Layout SectionField Group SectionField Group SectionA report section which is repeated for every matching feature within a layerA report section which is repeated for every matching feature within a layerRemove SectionRemove SectionAre you sure you want to remove the report section?Are you sure you want to remove the report section?QgsReportSectionFieldGroupWidgetHeader: %1Header: %1Footer: %1Footer: %1Body: %1Body: %1QgsReportSectionModelSectionSectionQgsReportSectionWidgetReport HeaderReport HeaderReport FooterReport FooterQgsReportWidgetFieldGroupSectionBaseLayout ManagerLayout ManagerEditEditFieldFieldSort ascendingSort ascendingEdit the field group header layoutEdit the field group header layoutSort features ascendingly by field valueSort features ascendingly by field valueLayerLayerEdit the field group footer layoutEdit the field group footer layoutInclude a footer layout after the last matching featureInclude a footer layout after the last matching featureInclude footerInclude footerSource field to iterate overSource field to iterate overIf unchecked, the header will only be shown when at least one matching feature is foundIf unchecked, the header will only be shown when at least one matching feature is foundSource layer to iterate overSource layer to iterate overInclude a header layout before the first matching featureInclude a header layout before the first matching featureInclude a separate layout for every matching feature foundInclude a separate layout for every matching feature foundEdit the field group body layoutEdit the field group body layoutIf unchecked, the footer will only be shown when at least one matching feature is foundIf unchecked, the footer will only be shown when at least one matching feature is foundShow footer when no matching
features are foundShow footer when no matching
features are foundInclude headerInclude headerShow header when no matching
features are foundShow header when no matching
features are foundInclude bodyInclude bodyQgsReportWidgetLayoutSectionBaseLayout ManagerLayout ManagerEdit the static layoutEdit the static layoutEditEditInclude a static layout inserted into the reportInclude a static layout inserted into the reportInclude sectionInclude sectionQgsReportWidgetSectionBaseLayout ManagerLayout ManagerEdit the report header layoutEdit the report header layoutEditEditInclude a layout at the very beginning of the reportInclude a layout at the very beginning of the reportInclude report headerInclude report headerInclude a layout at the very end of the reportInclude a layout at the very end of the reportInclude report footerInclude report footerEdit the report footer layoutEdit the report footer layoutQgsRuleBasedLabelingModel(no filter)(no filter)LabelLabelRuleRuleMin. scaleMin. scaleMax. scaleMax. scaleTextTextQgsRuleBasedLabelingWidgetAdd ruleAdd ruleEdit ruleEdit ruleRemove ruleRemove ruleCopyCopyPastePasteRemove RuleRemove RuleEdit RuleEdit RuleQgsRuleBasedRendererModel(no filter)(no filter)<li><nobr>%1 features also in rule %2</nobr></li><li><nobr>%1 features also in rule %2</nobr></li>LabelLabelRuleRuleMin. scaleMin. scaleMax. scaleMax. scaleCountCountDuplicate countDuplicate countNumber of features in this rule.Number of features in this rule.Number of features in this rule which are also present in other rule(s).Number of features in this rule which are also present in other rule(s).QgsRuleBasedRendererWidgetAdd ruleAdd ruleRemove selected rulesRemove selected rulesEdit current ruleEdit current ruleCount featuresCount featuresSymbol Levels...Symbol Levels...Refine Selected RulesRefine Selected RulesRemove RuleRemove RuleRefine Current RuleRefine Current RuleAdd Scales to RuleAdd Scales to RuleAdd Categories to RuleAdd Categories to RuleAdd Ranges to RuleAdd Ranges to RuleEdit RuleEdit RuleAdd Categories to RulesAdd Categories to RulesAdd Ranges to RulesAdd Ranges to RulesParent rule %1 must have a symbol for this operation.Parent rule %1 must have a symbol for this operation.Scale RefinementScale RefinementPlease enter scale denominators at which will split the rule, separate them by commas (e.g. 1000,5000):Please enter scale denominators at which will split the rule, separate them by commas (e.g. 1000,5000):"%1" is not valid scale denominator, ignoring it."%1" is not valid scale denominator, ignoring it.Symbol LevelsSymbol LevelsCalculating feature count.Calculating feature count.AbortAbortQgsRunProcess<b>Starting %1...</b><b>Starting %1...</b>ActionActionUnable to run command
%1Unable to run command
%1DoneDoneUnable to run command %1Unable to run command %1QgsSLConnectionItemDatabase does not existDatabase does not existFailed to open databaseFailed to open databaseFailed to check metadataFailed to check metadataFailed to get list of tablesFailed to get list of tablesUnknown errorUnknown errorDeleteDelete%1: %2%1: %2Failed to import layer!
Failed to import layer!
%1: Not a valid layer!%1: Not a valid layer!Import to SpatiaLite databaseImport to SpatiaLite databaseFailed to import some layers!
Failed to import some layers!
Import was successful.Import was successful.QgsSLLayerItemDelete LayerDelete LayerLayer deleted successfully.Layer deleted successfully.QgsSLRootItemNew Connection…New Connection…Create Database…Create Database…New SpatiaLite Database FileNew SpatiaLite Database FileSpatiaLiteSpatiaLiteCreate SpatiaLite databaseCreate SpatiaLite databaseFailed to create the database:
Failed to create the database:
QgsSQLComposerDialogAn error occurred during evaluation of the SQL statement.An error occurred during evaluation of the SQL statement.SQL EvaluationSQL EvaluationThis is the SQL query editor. The SQL statement can select data from several tables,
but it must compulsory include the main typename%1 in the selected tables,
and only the geometry column of the main typename can be used as the geometry column of the resulting layer.This is the SQL query editor. The SQL statement can select data from several tables,
but it must compulsory include the main typename%1 in the selected tables,
and only the geometry column of the main typename can be used as the geometry column of the resulting layer.QgsSQLComposerDialogBaseSQL Query ComposerSQL Query ComposerSQL StatementSQL Statement<html><head/><body><p>This is the SQL query editor.</p></body></html><html><head/><body><p>This is the SQL query editor.</p></body></html>ColumnsColumnsTable(s)Table(s)JoinsJoinsJoint layerJoint layerON conditionON conditionWhere Where Order byOrder byDataDataTablesTablesAggregatesAggregatesFunctionsFunctionsSpatial predicatesSpatial predicatesStrings functionsStrings functionsOperatorsOperatorsColumns' valuesColumns' valuesOnly 10 first valuesOnly 10 first valuesQgsSQLStatement(no root)(no root)No root nodeNo root nodeTable %1 is referenced by column %2, but not selected in FROM / JOIN.Table %1 is referenced by column %2, but not selected in FROM / JOIN.[unsupported type: %1; value: %2][unsupported type: %1; value: %2]QgsSVGFillSymbolLayerWidgetSelect Fill ColorSelect Fill ColorSelect Stroke ColorSelect Stroke ColorQgsScaleRangeWidgetMinimum (exclusive)Minimum (exclusive)Minimum scale, i.e. most "zoomed out". This limit is exclusive, that means the layer will not be displayed on this scale.Minimum scale, i.e. most "zoomed out". This limit is exclusive, that means the layer will not be displayed on this scale.Maximum scale, i.e. most "zoomed in". This limit is inclusive, that means the layer will be displayed on this scale.Maximum scale, i.e. most "zoomed in". This limit is inclusive, that means the layer will be displayed on this scale.Maximum (inclusive)Maximum (inclusive)QgsScaleRangeWidgetPluginA widget to define the scale rangeA widget to define the scale rangeA widget to define the scale range.A widget to define the scale range.QgsScaleVisibilityDialogScale visibility Scale visibility QgsScaleWidgetSet to current canvas scaleSet to current canvas scaleQgsScaleWidgetPluginA widget to define the scaleA widget to define the scaleA widget to define the scale.A widget to define the scale.QgsScrollAreaWidgetPluginScroll areaScroll areaQgsSearchQueryBuilderSearch Query BuilderSearch Query Builder&Test&Test&Clear&ClearTest QueryTest QueryQuery ResultQuery ResultSave Query to FileSave Query to FileCould not open file for writing.Could not open file for writing.Load Query from FileLoad Query from FileCould not open file for reading.Could not open file for reading.File is not a valid xml document.File is not a valid xml document.File is not a valid query document.File is not a valid query document.Select AttributeSelect AttributeThere is no attribute '%1' in the current vector layer. Please select an existing attribute.There is no attribute '%1' in the current vector layer. Please select an existing attribute.Save query to an xml fileSave query to an xml file&Save…&Save…&Load…&Load…Load query from xml fileLoad query from xml fileFound %n matching feature(s).test resultFound %n matching feature(s).Found %n matching feature(s).The query you specified results in zero records being returned.The query you specified results in zero records being returned.Query filesQuery filesAll filesAll filesQgsSearchWidgetToolButtonExclude FieldExclude FieldExclude fieldExclude fieldQgsSelectByFormDialogSelect Features by ValueSelect Features by ValueZoomed to %n matching feature(s)number of matching featuresZoomed to %n matching feature(s)Zoomed to %n matching feature(s)No matching features foundNo matching features foundQgsSelectLayerTreeModelThe source of this layer is a <b>WFS</b> server.<br>Some WFS layers are not suitable for offline<br>editing due to unstable primary keys<br>please check with your system administrator<br>if this WFS layer can be used for offline<br>editing.The source of this layer is a <b>WFS</b> server.<br>Some WFS layers are not suitable for offline<br>editing due to unstable primary keys<br>please check with your system administrator<br>if this WFS layer can be used for offline<br>editing.QgsSelectedFeatureValidation started.Validation started.Validation finished (%n error(s) found).number of geometry errorsValidation finished (%n error(s) found).Validation finished (%n error(s) found).ring %1, vertex %2ring %1, vertex %2QgsSettingsLocatorFilterOptionsOptionsProject PropertiesProject PropertiesSettingsSettingsQgsSettingsTreeSettingSettingTypeTypeValueValueDescriptionDescriptionQgsShadowEffectWidgetSelect Shadow ColorSelect Shadow ColorQgsShapeburstFillSymbolLayerWidgetSelect Gradient ColorSelect Gradient ColorTransparentTransparentQgsSimpleFillSymbolLayerWidgetSelect Fill ColorSelect Fill ColorTransparent FillTransparent FillTransparent StrokeTransparent StrokeSelect Stroke ColorSelect Stroke ColorQgsSimpleLineSymbolLayerWidgetSelect Line ColorSelect Line ColorQgsSimpleMarkerSymbolLayerWidgetSelect Fill ColorSelect Fill ColorTransparent FillTransparent FillSelect Stroke ColorSelect Stroke ColorTransparent StrokeTransparent StrokeQgsSimplifyUserInputWidgetSimplify by distanceSimplify by distanceSimplify by snapping to gridSimplify by snapping to gridSimplify by area (Visvalingam)Simplify by area (Visvalingam)SmoothSmoothLayer unitsLayer unitsPixelsPixelsMap unitsMap unitsQgsSingleBandGrayRendererWidgetBlack to whiteBlack to whiteWhite to blackWhite to blackNo enhancementNo enhancementStretch to MinMaxStretch to MinMaxStretch and clip to MinMaxStretch and clip to MinMaxClip to MinMaxClip to MinMaxQgsSingleBandGrayRendererWidgetBaseFormFormContrast
enhancementContrast
enhancementGray bandGray bandMinMinMaxMaxColor gradientColor gradientQgsSingleBandPseudoColorRendererWidgetBaseFormFormBandBandMinMinMaxMaxQgsSingleSymbolRendererWidgetSymbol Levels…Symbol Levels…Data-defined Size Legend…Data-defined Size Legend…QgsSmartGroupConditionhas the taghas the taghas a part of name matchinghas a part of name matchingdoes NOT have the tagdoes NOT have the taghas NO part of name matchinghas NO part of name matchingQgsSmartGroupConditionWidgetFormFormThe symbolThe symbolQgsSmartGroupEditorDialogALL the constraintsALL the constraintsany ONE of the constraintsany ONE of the constraintsEdit Smart GroupEdit Smart GroupThe smart group name field is empty. Kindly provide a name.The smart group name field is empty. Kindly provide a name.QgsSmartGroupEditorDialogBaseSmart Group EditorSmart Group EditorSmart group nameSmart group nameCondition matchesCondition matchesAdd ConditionAdd ConditionConditionsConditionsQgsSnappingLayerDelegatepxpxQgsSnappingLayerTreeModelLayerLayerTypeTypeToleranceToleranceUnitsUnitsAvoid intersectionAvoid intersectionvertexvertexvertex and segmentvertex and segmentsegmentsegmentpixelspixelsQgsSnappingWidgetFilter layers…Filter layers…Toggle SnappingToggle SnappingEnable Snapping (S)Enable Snapping (S)SKeyboard shortcut: toggle snappingSSnapping ModeSnapping ModeSet Snapping ModeSet Snapping ModeAll LayersAll LayersActive LayerActive LayerAdvanced ConfigurationAdvanced ConfigurationOpen Snapping Options…Open Snapping Options…Vertex and SegmentVertex and SegmentTopological EditingTopological EditingSnapping on IntersectionSnapping on IntersectionEnable TracingEnable TracingSnapping TypeSnapping TypeVertexVertexSegmentSegmentSnapping Tolerance in Defined UnitsSnapping Tolerance in Defined UnitspxpxSnapping Unit Type: Pixels (px) or Map Units (mu)Snapping Unit Type: Pixels (px) or Map Units (mu)Edit advanced configurationEdit advanced configurationEnable Topological EditingEnable Topological EditingEnable Snapping on IntersectionEnable Snapping on IntersectionEnable Tracing (T)Enable Tracing (T)TKeyboard shortcut: Enable tracingTQgsSourceFieldsPropertiesFormFormToggle editing modeToggle editing modeClick to toggle table editingClick to toggle table editingNew fieldNew fieldCtrl+NCtrl+NDelete fieldDelete fieldCtrl+XCtrl+XField calculatorField calculatorIdIdNameNameTypeTypeType nameType nameLengthLengthPrecisionPrecisionCommentCommentAliasAliasEdit alias in the Form config tabEdit alias in the Form config tabAdded attributeAdded attributeRename FieldRename FieldFailed to add field '%1' of type '%2'. Is the field name unique?Failed to add field '%1' of type '%2'. Is the field name unique?Add FieldAdd FieldDeleted attributesDeleted attributesRename attributeRename attributeFailed to rename field to '%1'. Is the field name unique?Failed to rename field to '%1'. Is the field name unique?QgsSpatiaLiteConnectionunknown error causeunknown error causeobsolete libspatialite: AbstractInterface is unsupportedobsolete libspatialite: AbstractInterface is unsupportedtable info on %1 failedtable info on %1 failedUNKNOWNUNKNOWNGEOMETRYGEOMETRYPOINTPOINTLINESTRINGLINESTRINGPOLYGONPOLYGONMULTIPOINTMULTIPOINTMULTILINESTRINGMULTILINESTRINGMULTIPOLYGONMULTIPOLYGONGEOMETRYCOLLECTIONGEOMETRYCOLLECTIONQgsSpatiaLiteProviderBinary object (BLOB)Binary object (BLOB)TextTextDecimal number (double)Decimal number (double)Whole number (integer)Whole number (integer)Array of textArray of textArray of decimal numbers (double)Array of decimal numbers (double)Array of whole numbers (integer)Array of whole numbers (integer)Retrieval of spatialite version failedRetrieval of spatialite version failedSpatiaLiteSpatiaLiteCould not parse spatialite version string '%1'Could not parse spatialite version string '%1'AutogenerateAutogenerateSQLite error: %2
SQL: %1SQLite error: %2
SQL: %1unknown causeunknown causeSQLite error while trying to inject ROWID: %2
SQL: %1SQLite error while trying to inject ROWID: %2
SQL: %1FAILURE: Field %1 not found.FAILURE: Field %1 not found.QgsSpatiaLiteSourceSelectAdd SpatiaLite Layer(s)Add SpatiaLite Layer(s)&Update Statistics&Update Statistics&Set Filter&Set FilterWildcardWildcardRegExpRegExpAllAllTableTableTypeTypeGeometry columnGeometry columnSqlSqlAre you sure you want to update the internal statistics for DB: %1?
This could take a long time (depending on the DB size), but implies better performance thereafter.Are you sure you want to update the internal statistics for DB: %1?
This could take a long time (depending on the DB size), but implies better performance thereafter.Confirm Update StatisticsConfirm Update StatisticsUpdate StatisticsUpdate StatisticsInternal statistics successfully updated for: %1Internal statistics successfully updated for: %1Error while updating internal statistics for: %1Error while updating internal statistics for: %1@@Choose a SpatiaLite/SQLite DB to openChoose a SpatiaLite/SQLite DB to openSpatiaLite DBSpatiaLite DBAll filesAll filesCannot add connection '%1'Cannot add connection '%1'A connection with the same name already exists,
please provide a new name:A connection with the same name already exists,
please provide a new name:Are you sure you want to remove the %1 connection and all associated settings?Are you sure you want to remove the %1 connection and all associated settings?Confirm DeleteConfirm DeleteSelect TableSelect TableYou must select a table in order to add a Layer.You must select a table in order to add a Layer.SpatiaLite DB Open ErrorSpatiaLite DB Open ErrorDatabase does not exist: %1Database does not exist: %1Failure while connecting to: %1
%2Failure while connecting to: %1
%2SpatiaLite getTableInfo ErrorSpatiaLite getTableInfo ErrorFailure exploring tables from: %1
%2Failure exploring tables from: %1
%2SpatiaLite metadata check failedSpatiaLite metadata check failedFailure getting table metadata... is %1 really a SpatiaLite database?
%2Failure getting table metadata... is %1 really a SpatiaLite database?
%2SpatiaLite ErrorSpatiaLite ErrorUnexpected error when working with %1
%2Unexpected error when working with %1
%2QgsSpatiaLiteTableModelTableTableTypeTypeGeometry columnGeometry columnSqlSqlPointPointMultipointMultipointLineLineMultilineMultilinePolygonPolygonMultipolygonMultipolygonQgsSpatialiteSridsDialogBaseSelect a SpatiaLite Spatial Reference SystemSelect a SpatiaLite Spatial Reference SystemSRIDSRIDAuthorityAuthorityReference NameReference NameSearchSearchFilterFilterNameNameQgsStatisticalSummaryDockWidgetMissing (null) valuesMissing (null) values%1 seconds%1 secondsQgsStatisticalSummaryWidgetBaseStatisticsStatisticsCancelCancelStatisticStatisticValueValueSelected features onlySelected features onlyCopy Statistics to ClipboardCopy Statistics to ClipboardRecalculate StatisticsRecalculate Statistics……QgsStatisticsValueGathererFetching statistic valuesFetching statistic valuesQgsStatusBarCoordinatesWidgetCoordinate:Coordinate:Current map coordinateCurrent map coordinateCoordinateCoordinateShows the map coordinates at the current cursor position. The display is continuously updated as the mouse is moved. It also allows editing to set the canvas center to a given position. The format is longitude,latitude or east,northShows the map coordinates at the current cursor position. The display is continuously updated as the mouse is moved. It also allows editing to set the canvas center to a given position. The format is longitude,latitude or east,northCurrent map coordinate (longitude,latitude or east,north)Current map coordinate (longitude,latitude or east,north)Toggle extents and mouse position displayToggle extents and mouse position displayQGIS ContributorsQGIS ContributorsWorld MapWorld MapQGIS HackfestsQGIS HackfestsMap coordinates for the current view extentsMap coordinates for the current view extentsMap coordinates at mouse cursor positionMap coordinates at mouse cursor positionExtents:Extents:QgsStatusBarMagnifierWidgetMagnifierMagnifierMagnifier levelMagnifier levelLock the scale to use magnifier to zoom in or out.Lock the scale to use magnifier to zoom in or out.QgsStatusBarScaleWidgetScaleScaleCurrent map scaleCurrent map scaleDisplays the current map scaleDisplays the current map scaleCurrent map scale (formatted as x:y)Current map scale (formatted as x:y)QgsStyleExportImportDialogImportImportExportExportImport Item(s)Import Item(s)FileFileURLURLSelect items to importSelect items to importExport Item(s)Export Item(s)Select by GroupSelect by GroupExport/import Item(s)Export/import Item(s)Save StylesSave StylesImport Symbols or Color RampsImport Symbols or Color RampsExport/import SymbolsExport/import SymbolsSelect Item(s) by GroupSelect Item(s) by GroupLoad StylesLoad StylesSelect AllSelect AllClear SelectionClear SelectionImport from URLImport from URLHTTP Error! Download failed: %1.HTTP Error! Download failed: %1.You should select at least one symbol/color ramp.You should select at least one symbol/color ramp.XML files (*.xml *.XML)XML files (*.xml *.XML)Export SymbolsExport SymbolsError when saving selected symbols to file:
%1Error when saving selected symbols to file:
%1The selected symbols were successfully exported to file:
%1The selected symbols were successfully exported to file:
%1An error occurred during import:
%1An error occurred during import:
%1Symbol with name '%1' already exists.
Overwrite?Symbol with name '%1' already exists.
Overwrite?Export/import Color RampsExport/import Color RampsColor ramp with name '%1' already exists.
Overwrite?Color ramp with name '%1' already exists.
Overwrite?Downloading style…Downloading style…QgsStyleExportImportDialogBaseStyles Import/ExportStyles Import/ExportImport fromImport fromLocationLocationAdditional tag(s)Additional tag(s)Add to favoritesAdd to favoritesDo not import embedded tagsDo not import embedded tagsTip: separate multiple tags with commasTip: separate multiple tags with commasFetch ItemsFetch ItemsSelect items to exportSelect items to exportQgsStyleGroupSelectionDialogAllAllTagsTagsSmart GroupsSmart GroupsQgsStyleManagerDialogFilter symbols…Filter symbols…GradientGradientColor presetsColor presetsRandomRandomCatalog: cpt-cityCatalog: cpt-cityCatalog: ColorBrewerCatalog: ColorBrewerShare MenuShare MenuExport Item(s)…Export Item(s)…Import Item(s)…Import Item(s)…Group ActionsGroup ActionsAdd to TagAdd to TagMarker symbol (%1)Marker symbol (%1)Line symbol (%1)Line symbol (%1)Fill symbol (%1)Fill symbol (%1)Color ramp (%1)Color ramp (%1)Filter color ramps…Filter color ramps…Not taggedNot taggednew symbolnew symbolnew markernew markernew linenew linenew fill symbolnew fill symbolSave SymbolSave SymbolColor Ramp TypeColor Ramp TypeRemove SymbolRemove SymbolSave ItemSave ItemExport Selected Symbols as PNGExport Selected Symbols as PNGExport Selected Symbols as SVGExport Selected Symbols as SVGAllAllAdd TagAdd TagRemove GroupRemove GroupInvalid selection. Cannot delete system defined categories.
Kindly select a group or smart group you might want to delete.Invalid selection. Cannot delete system defined categories.
Kindly select a group or smart group you might want to delete.Group ItemsGroup ItemsThere was a problem with the symbols database while regrouping.There was a problem with the symbols database while regrouping.Create New Tag…Create New Tag…Edit Smart GroupEdit Smart GroupCannot save symbol without name. Enter a name.Cannot save symbol without name. Enter a name.Symbol with name '%1' already exists. Overwrite?Symbol with name '%1' already exists. Overwrite?Symbol NameSymbol NamePlease enter a name for new symbol:Please enter a name for new symbol:Please select color ramp type:Please select color ramp type:new rampnew rampnew gradient rampnew gradient rampnew random rampnew random rampnew preset rampnew preset rampSave Color RampSave Color RampCannot save color ramp without name. Enter a name.Cannot save color ramp without name. Enter a name.Color ramp with name '%1' already exists. Overwrite?Color ramp with name '%1' already exists. Overwrite?Color Ramp NameColor Ramp NamePlease enter a name for new color ramp:Please enter a name for new color ramp:Do you really want to remove %n symbol(s)?Do you really want to remove %n symbol(s)?Do you really want to remove %n symbol(s)?Remove Color RampRemove Color RampDo you really want to remove %n ramp(s)?Do you really want to remove %n ramp(s)?Do you really want to remove %n ramp(s)?Name is already taken by another item. Choose a different name.Name is already taken by another item. Choose a different name.FavoritesFavoritesTagsTagsSmart GroupsSmart GroupsPlease enter name for the new tag:Please enter name for the new tag:New tagNew tagTag name already exists in your symbol database.Tag name already exists in your symbol database.New tag could not be created.
There was a problem with your symbol database.New tag could not be created.
There was a problem with your symbol database.You have not selected a Smart Group. Kindly select a Smart Group to edit.You have not selected a Smart Group. Kindly select a Smart Group to edit.There was some error while editing the smart group.There was some error while editing the smart group.QgsStyleManagerDialogBaseStyle ManagerStyle ManagerModify selected tag or smart groupModify selected tag or smart groupMarkerMarkerLineLineFillFillColor rampColor rampAdd itemAdd itemRemove itemRemove itemEdit itemEdit itemRemove Item(s)…Remove Item(s)…Remove Item(s)Remove Item(s)Edit Item…Edit Item…Edit ItemEdit ItemAdd to FavoritesAdd to FavoritesRemove from FavoritesRemove from FavoritesClear TagsClear TagsEdit Smart Group…Edit Smart Group…Edit Smart GroupEdit Smart GroupAdd Tag…Add Tag…Add TagAdd TagAdd Smart Group…Add Smart Group…Modify GroupModify GroupImport / ExportImport / ExportAdd Smart GroupAdd Smart GroupAttach Selected Tag to SymbolsAttach Selected Tag to SymbolsFinish TaggingFinish TaggingExport Selected Symbol(s) as PNG…Export Selected Symbol(s) as PNG…Export Selected Symbol(s) as PNGExport Selected Symbol(s) as PNGExport Selected Symbol(s) as SVG…Export Selected Symbol(s) as SVG…Export Selected Symbol(s) as SVGExport Selected Symbol(s) as SVGRemoveRemoveQgsStyleModelNot taggedNot taggedNameNameTagsTagsQgsStyleSaveDialogSave New StyleSave New StyleNameNameAdd to favoritesAdd to favoritesTag(s)Tag(s)Tip: separate multiple tags with commasTip: separate multiple tags with commasSave New SymbolSave New SymbolSave New Color RampSave New Color RampQgsSublayersDialogSelect Vector Layers to Add…Select Vector Layers to Add…Layer IDLayer IDLayer nameLayer nameNumber of featuresNumber of featuresGeometry typeGeometry typeSelect Raster Layers to Add…Select Raster Layers to Add…Select Layers to Add…Select Layers to Add…Add layers to a groupAdd layers to a groupUnknownUnknownTypeTypeSelect AllSelect AllQgsSublayersDialogBaseSelect Layers to LoadSelect Layers to Load11QgsSubstitutionListDialogSubstitutionsSubstitutionsQgsSubstitutionListWidgetXML files (*.xml *.XML)XML files (*.xml *.XML)Import substitutionsImport substitutionsSave SubstitutionsSave SubstitutionsExport SubstitutionsExport SubstitutionsCannot write file %1:
%2Cannot write file %1:
%2. {1:?} {2?}Load SubstitutionsLoad SubstitutionsImport SubstitutionsImport SubstitutionsCannot read file %1:
%2Cannot read file %1:
%2. {1:?} {2?}Parse error at line %1, column %2:
%3Parse error at line %1, column %2:
%3The selected file is not a substitution list.The selected file is not a substitution list.QgsSubstitutionListWidgetBaseFormFormTextTextSubstitutionSubstitutionCase SensitiveCase SensitiveWhole WordWhole WordIf checked, only whole word matches are replacedIf checked, only whole word matches are replaced……QgsSvgAnnotationDialogSVG AnnotationSVG AnnotationDeleteDeleteSelect SVG fileSelect SVG fileSVG filesSVG filesQgsSvgCacheSVG request failed [error: %1 - url: %2]SVG request failed [error: %1 - url: %2]SVGSVGSVG request error [status: %1 - reason phrase: %2] for %3SVG request error [status: %1 - reason phrase: %2] for %3Unexpected MIME type %1 received for %2Unexpected MIME type %1 received for %2%1 of %2 bytes of svg image downloaded.%1 of %2 bytes of svg image downloaded.QgsSvgExportOptionsDialogSVG Export OptionsSVG Export OptionsSVG OptionsSVG OptionsExport map layers as SVG groups (may affect label placement)Export map layers as SVG groups (may affect label placement)Uncheck to render map labels as text objects. This will degrade the quality of the map labels but allow editing in vector illustration software.Uncheck to render map labels as text objects. This will degrade the quality of the map labels but allow editing in vector illustration software.Render map labels as outlinesRender map labels as outlinesIf checked, the layout will always be kept as vector objects when exported to a compatible format, even if the appearance of the resultant file does not match the layouts settings. If unchecked, some elements in the layout may be rasterized in order to keep their appearance intact.If checked, the layout will always be kept as vector objects when exported to a compatible format, even if the appearance of the resultant file does not match the layouts settings. If unchecked, some elements in the layout may be rasterized in order to keep their appearance intact.Always export as vectorsAlways export as vectorsExport RDF metadataExport RDF metadataCrop to ContentCrop to ContentLeftLeftRightRightBottomBottomTop margin (mm)Top margin (mm)QgsSvgMarkerSymbolLayerWidgetSelect Fill colorSelect Fill colorSelect Stroke ColorSelect Stroke ColorQgsSvgSelectorGroupsModelApp SymbolsApp SymbolsUser SymbolsUser SymbolsQgsSvgSourceLineEdit……Select File…Select File…Embed File…Embed File…Extract Embedded File…Extract Embedded File…From URL…From URL…Select SVG fileSelect SVG fileSVG filesSVG filesSVG From URLSVG From URLEnter SVG URLEnter SVG URLEmbed SVG FileEmbed SVG FileExtract SVG FileExtract SVG FileQgsSymbolButtonSymbol SettingsSymbol SettingsConfigure Symbol…Configure Symbol…Copy SymbolCopy SymbolPaste SymbolPaste SymbolCopy ColorCopy ColorPaste ColorPaste ColorQgsSymbolButtonPluginSelect symbolSelect symbolQgsSymbolLegendNodeN/AN/AQgsSymbolLevelsDialogSymbol LevelsSymbol LevelsQgsSymbolLevelsDialogBaseSymbol LevelsSymbol LevelsEnable symbol levelsEnable symbol levelsDefine the order in which the symbol layers are rendered. The numbers in the cells define in which rendering pass the layer will be drawn.Define the order in which the symbol layers are rendered. The numbers in the cells define in which rendering pass the layer will be drawn.QgsSymbolLevelsWidgetLayer %1Layer %1QgsSymbolSelectorDialogSymbol SelectorSymbol SelectorQgsSymbolSelectorDialogBaseFormFormAdd symbol layerAdd symbol layerRemove symbol layerRemove symbol layerLock layer's colorLock layer's colorDuplicates the current layerDuplicates the current layerMove upMove upMove downMove downQgsSymbolSelectorWidgetSymbol SelectorSymbol SelectorQgsSymbolsListWidgetClip Features to Canvas ExtentClip Features to Canvas ExtentFilter symbols…Filter symbols…Select ColorSelect ColorFavoritesFavoritesAll SymbolsAll SymbolsSave SymbolSave SymbolPlease enter name for the symbol:Please enter name for the symbol:New symbolNew symbolSymbol with name '%1' already exists. Overwrite?Symbol with name '%1' already exists. Overwrite?QgsTableWidgetUiBaseFormFormAdd entryAdd entry……Remove entryRemove entryQgsTaskManagerModelQueuedQueuedOn holdOn holdRunning (cannot cancel)Running (cannot cancel)RunningRunningCompleteCompleteTerminatedTerminated%1:%2 minutes%1:%2 minutes%1 seconds%1 secondsEstimated time remaining: %1Estimated time remaining: %1 (%1) (%1)Time elapsed: %1Time elapsed: %1%1<br>%2%1<br>%2QgsTaskManagerStatusBarWidget%1 active tasks running%1 active tasks runningQgsTextAnnotationDialogSelect Font ColorSelect Font ColorDeleteDeleteQgsTextAnnotationDialogBaseAnnotation TextAnnotation TextBBIIQgsTextEditConfigDlgFormFormMultilineMultilineHTMLHTMLQgsTextFormatDialogText SettingsText SettingsQgsTextFormatWidgetOver the feature's interiorOver the feature's interiorOver the feature's boundaryOver the feature's boundaryFrom pointFrom pointFrom symbol boundsFrom symbol boundsSelect Fill ColorSelect Fill ColorSelect Text ColorSelect Text ColorSelect Buffer ColorSelect Buffer ColorSelect Stroke ColorSelect Stroke ColorSelect Shadow ColorSelect Shadow ColorTextTextFormattingFormattingBufferBufferBackgroundBackgroundShadowShadowPlacementPlacementRenderingRendering%1 not found. Default substituted.%1 not found. Default substituted.Chosen fontChosen fontNo changeNo changeAll uppercaseAll uppercaseAll lowercaseAll lowercaseCapitalize first letterCapitalize first letterSize%1Size%1 X XFile not foundFile not foundSelect SVG fileSelect SVG fileLeft of lineLeft of lineRight of lineRight of lineAbove lineAbove lineBelow lineBelow lineSubstitutionsSubstitutionsQgsTextFormatWidgetBaseLayer Labeling SettingsLayer Labeling SettingsLabel withLabel withText SampleText SampleLorem IpsumLorem IpsumSample textSample textReset sample textReset sample text……Preview text at specific map scalePreview text at specific map scaleSample background colorSample background colorTextTextText styleText styleFormattingFormattingBufferBufferBackgroundBackgroundShadowShadowPlacementPlacementRenderingRenderingSpacingSpacingUnderlined textUnderlined textUUStrikeout textStrikeout textSSBold text
(data defined only, overrides Style)Bold text
(data defined only, overrides Style)BBItalic text
(data defined only, overrides Style)Italic text
(data defined only, overrides Style)IIletterletterSpace in pixels or map units, relative to size unit choiceSpace in pixels or map units, relative to size unit choicewordwordStyleStyleAvailable typeface stylesAvailable typeface stylesSizeSizeType caseType caseCapitalization style of textCapitalization style of textColorColorBlend modeBlend modeFont is missing.Font is missing.If enabled, the label text will automatically be modified using a preset list of substitutesIf enabled, the label text will automatically be modified using a preset list of substitutesApply label text substitutesApply label text substitutesConfigure substitutesConfigure substitutesFontFontOpacityOpacityMultiple linesMultiple linesWrap on characterWrap on characterLine heightLine heightLine height spacing for multi-line textLine height spacing for multi-line text line lineAlignmentAlignmentWrap lines toWrap lines toParagraph style alignment of multi-line textParagraph style alignment of multi-line textLeftLeftCenterCenterRightRightIf set, label text will automatically be wrapped to match the specified number of characters per line (if possible)If set, label text will automatically be wrapped to match the specified number of characters per line (if possible)No automatic wrappingNo automatic wrapping characters charactersControls whether lines are automatically wrapped using the maximum number of characters in a line, or the minimumControls whether lines are automatically wrapped using the maximum number of characters in a line, or the minimumMaximum line lengthMaximum line lengthMinimum line lengthMinimum line lengthLine direction symbolLine direction symbol>>Reverse directionReverse direction<<left/rightleft/rightaboveabovebelowbelowFormatted numbersFormatted numbersDecimal places Decimal places Show plus signShow plus signDraw text bufferDraw text bufferPen join stylePen join styleColor buffer's fillColor buffer's fillDraw backgroundDraw backgroundRadius X,YRadius X,Ysymbol unitssymbol unitsStroke widthStroke widthFixedFixedSize YSize YLoad symbol parametersLoad symbol parametersShapeShapeSize XSize XOffset X,YOffset X,YSync with labelSync with labelOffset of labelOffset of labelSize typeSize typeStroke colorStroke colorFill colorFill colorRotationRotationRectangleRectangleSquareSquareEllipseEllipseCircleCircleSVGSVGDraw drop shadowDraw drop shadowScaleScaleBlur radiusBlur radiusBlur only alpha pixelsBlur only alpha pixelsLabel's rotation is ignoredLabel's rotation is ignoredUse global shadowUse global shadow˚˚Lowest label componentLowest label componentDraw underDraw under % %OffsetOffsetLabels are placed in an equal radius circle around point features.Labels are placed in an equal radius circle around point features.Around pointAround pointLabels are placed at a fixed offset from the point.Labels are placed at a fixed offset from the point.Offset from pointOffset from pointUses 'ideal' cartographic placements, prioritizing label placement with best visual relationship with the point featureUses 'ideal' cartographic placements, prioritizing label placement with best visual relationship with the point featureCartographicCartographicCurvedCurvedParallelParallelHorizontalHorizontalOffset from centroidOffset from centroidHorizontal (slow)Horizontal (slow)Around centroidAround centroidFree (slow)Free (slow)Using perimeterUsing perimeterUsing perimeter (curved)Using perimeter (curved)Allowed label placement for lines. At least one position must be selected.Allowed label placement for lines. At least one position must be selected.Allowed positionsAllowed positionsAbove lineAbove lineOn lineOn lineBelow lineBelow lineLine orientation dependent positionLine orientation dependent positionCentroidCentroidvisible polygonvisible polygonwhole polygonwhole polygonForce point inside polygonForce point inside polygonDistanceDistanceDistance offset fromDistance offset fromabcabcQuadrantQuadrantPosition priorityPosition priorityRepeatRepeatNo repeatNo repeatinsideinsideoutsideoutsideMaximum angle between curved charactersMaximum angle between curved charactersData definedData definedXXYYCoordinateCoordinateUncheck to write labeling engine derived rotation on pin and NULL on unpinUncheck to write labeling engine derived rotation on pin and NULL on unpinPreserve data rotation valuesPreserve data rotation valueshorizontalhorizontalverticalverticalPriorityPriorityLowLowHighHighLabel optionsLabel optionsScale dependent visibilityScale dependent visibilityMaximum scale, i.e. most "zoomed in".Maximum scale, i.e. most "zoomed in".Minimum scale, i.e. most "zoomed out".Minimum scale, i.e. most "zoomed out".Labels will not show if smaller than this on screenLabels will not show if smaller than this on screen px pxMinimum Minimum Labels will not show if larger than this on screenLabels will not show if larger than this on screenMaximum Maximum Pixel size-based visibility (labels in map units)Pixel size-based visibility (labels in map units)Label z-indexLabel z-indexControls how labels are drawn on top of each other. Labels with a higher z-index are drawn above labels and diagrams with a lower z-index.Controls how labels are drawn on top of each other. Labels with a higher z-index are drawn above labels and diagrams with a lower z-index.Show all labels for this layer (including colliding labels)Show all labels for this layer (including colliding labels)Always showAlways showShow labelShow labelalwaysalwaysneverneverwhen rotation definedwhen rotation definedShow upside-down labelsShow upside-down labelsFeature optionsFeature optionsLabel every part of multi-part featuresLabel every part of multi-part featuresMerge connected lines to avoid duplicate labelsMerge connected lines to avoid duplicate labelsNumber of features sent to labeling engine, though not all may be labeledNumber of features sent to labeling engine, though not all may be labeledLimit number of features to be labeled toLimit number of features to be labeled to mm mmSuppress labeling of features smaller thanSuppress labeling of features smaller thanOnly draw labels which fit completely within featureOnly draw labels which fit completely within featureObstaclesObstaclesDiscourage labels from covering featuresDiscourage labels from covering featuresLow weightLow weightControls how likely labels are to cover features in this layerControls how likely labels are to cover features in this layerHigh weightHigh weightMinimize placing labelsMinimize placing labelsQgsTileScaleWidgetFormFormZoom level: %1Zoom level: %1Resolution: %1Resolution: %1Tile ScaleTile ScaleQgsTipGuiBaseQGIS Tips!QGIS Tips!<!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.0//EN" "http://www.w3.org/TR/REC-html40/strict.dtd">
<html><head><meta name="qrichtext" content="1" /><style type="text/css">
p, li { white-space: pre-wrap; }
</style></head><body style=" font-family:'Lucida Grande'; font-size:13pt; font-weight:400; font-style:normal;">
<p style=" margin-top:0px; margin-bottom:0px; margin-left:0px; margin-right:0px; -qt-block-indent:0; text-indent:0px;"><span style=" font-family:'Ubuntu'; font-size:10pt;">A nice tip goes here...</span></p></body></html><!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.0//EN" "http://www.w3.org/TR/REC-html40/strict.dtd">
<html><head><meta name="qrichtext" content="1" /><style type="text/css">
p, li { white-space: pre-wrap; }
</style></head><body style=" font-family:'Lucida Grande'; font-size:13pt; font-weight:400; font-style:normal;">
<p style=" margin-top:0px; margin-bottom:0px; margin-left:0px; margin-right:0px; -qt-block-indent:0; text-indent:0px;"><span style=" font-family:'Ubuntu'; font-size:10pt;">A nice tip goes here...</span></p></body></html>I've had enough tips, don't show this on start up any more!I've had enough tips, don't show this on start up any more!QgsTransactionCould not create savepoint (%1)Could not create savepoint (%1)QgsTransformOptionsDialogDialogDialogTransformation typeTransformation typeLinearLinearPolynomial 1Polynomial 1Polynomial 2Polynomial 2Polynomial 3Polynomial 3Thin plate spline (TPS)Thin plate spline (TPS)Generate ESRI world file (.tfw)Generate ESRI world file (.tfw)QgsTransformSettingsDialogTransformation SettingsTransformation SettingsTransformation parametersTransformation parametersTransformation typeTransformation typeNearest neighbourNearest neighbourLinearLinearCubicCubicCubic SplineCubic SplineLanczosLanczosResampling methodResampling methodTarget SRSTarget SRSOutput settingsOutput settingsOutput rasterOutput rasterSet target resolutionSet target resolutionCreate world file only (linear transforms)Create world file only (linear transforms)ReportsReportsGenerate PDF mapGenerate PDF mapGenerate PDF reportGenerate PDF reportHorizontalHorizontalVerticalVerticalCompressionCompressionUse 0 for transparency when neededUse 0 for transparency when neededLoad in QGIS when doneLoad in QGIS when doneHelmertHelmertPolynomial 1Polynomial 1Polynomial 2Polynomial 2Polynomial 3Polynomial 3Thin Plate SplineThin Plate SplineProjectiveProjectiveDestination RasterDestination RasterTIF filesTIF filesPDF filesPDF filesSave Map File AsSave Map File AsSave Report File AsSave Report File AsInvalid output file name.Invalid output file name.Input raster can not be overwritten.Input raster can not be overwritten._modifiedGeoreferencer:QgsOpenRasterDialog.cpp - used to modify a user given file name_modifiedQgsUniqueValuesConfigDlgBaseFormFormThe user can select one of the values already used in the field. If editable, a line edit is shown with autocompletion support, otherwise a combo box is used.The user can select one of the values already used in the field. If editable, a line edit is shown with autocompletion support, otherwise a combo box is used.EditableEditableQgsUnitSelectionWidgetFormFormAdjust scaling rangeAdjust scaling rangeMillimeterMillimeterPointsPointsPixelsPixelsMeters at ScaleMeters at ScaleAdjust Scaling RangeAdjust Scaling RangeMap UnitsMap UnitsInchesInchesPercentagePercentageQgsUserProfileManagerUnable to fully delete user profile folderUnable to fully delete user profile folderQgsUserProfileManagerWidgetFormFormAddAddRemoveRemoveProfiles FolderProfiles FolderProfilesProfilesQgsValueMapConfigDlgSelect a FileSelect a FileLoad Value Map from FileLoad Value Map from FileCould not open file %1
Error was: %2Could not open file %1
Error was: %2QgsValueMapSearchWidgetWrapperPlease selectPlease selectQgsValueMapWidgetFormFormCombo box with predefined items. Value is stored in the attribute, description is shown in the combo box.Combo box with predefined items. Value is stored in the attribute, description is shown in the combo box.Load Data from LayerLoad Data from LayerAdd "NULL" valueAdd "NULL" valueLoad Data from CSV FileLoad Data from CSV FileValueValueDescriptionDescriptionRemove SelectedRemove SelectedQgsValueRelationConfigDlgEdit Filter ExpressionEdit Filter ExpressionQgsValueRelationConfigDlgBaseFormFormSelect layer, key column and value columnSelect layer, key column and value columnLayerLayerKey columnKey columnValue columnValue columnOrder by valueOrder by valueAllow NULL valueAllow NULL valueNumber of columnsNumber of columnsAllow multiple selectionsAllow multiple selectionsUse completerUse completerFilter expressionFilter expressionQgsValueRelationSearchWidgetWrapperPlease selectPlease select(no selection)(no selection)QgsValueRelationWidgetWrapper(no selection)(no selection)QgsVariableEditorTreeVariableVariableValueValueOverridden by value from %1Overridden by value from %1QgsVariableEditorWidgetAdd variableAdd variableRemove variableRemove variableQgsVectorDataProviderCodec %1 not found. Falling back to system localeCodec %1 not found. Falling back to system localeAdd FeaturesAdd FeaturesDelete FeaturesDelete FeaturesChange Attribute ValuesChange Attribute ValuesAdd AttributesAdd AttributesDelete AttributesDelete AttributesRename AttributesRename AttributesCreate Spatial IndexCreate Spatial IndexCreate Attribute IndexesCreate Attribute IndexesFast Access to Features at IDFast Access to Features at IDChange GeometriesChange GeometriesPresimplify GeometriesPresimplify GeometriesPresimplify Geometries with Validity CheckPresimplify Geometries with Validity CheckSimultaneous Geometry and Attribute UpdatesSimultaneous Geometry and Attribute UpdatesTransactionsTransactionsCurved GeometriesCurved GeometriesQgsVectorFieldSymbolLayerWidgetX attributeX attributeY attributeY attributeLength attributeLength attributeAngle attributeAngle attributeHeight attributeHeight attributeQgsVectorFileWriterTaskSaving %1Saving %1QgsVectorLayerERROR: no providerERROR: no providerERROR: layer not editableERROR: layer not editableCommit errors:
%1Commit errors:
%1Primary key attributesPrimary key attributesSymbologySymbologyInformation from providerInformation from providerNameNamePathPathSourceSourceStorageStorageEncodingEncodingGeometryGeometryCRSCRSGeographicGeographicProjectedProjectedExtentExtentUnitUnitFeature countFeature countunknownunknownIdentificationIdentificationAccessAccessFieldsFieldsCountCountFieldFieldTypeTypeLengthLengthPrecisionPrecisionContactsContactsLinksLinksHistoryHistoryCommentCommentQgsVectorLayer3DRendererWidget3D View3D ViewEnable 3D RendererEnable 3D RendererSorry, this layer is not supported.Sorry, this layer is not supported.QgsVectorLayerAndAttributeModelLayerLayerOutput layer attributeOutput layer attributeAttribute containing the name of the destination layer in the DXF output.Attribute containing the name of the destination layer in the DXF output.QgsVectorLayerEditBufferSUCCESS: %n attribute(s) deleted.deleted attributes countSUCCESS: %n attribute(s) deleted.SUCCESS: %n attribute(s) deleted.ERROR: %n attribute(s) not deleted.not deleted attributes countERROR: %n attribute(s) not deleted.ERROR: %n attribute(s) not deleted.SUCCESS: %n attribute(s) added.added attributes countSUCCESS: %n attribute(s) added.SUCCESS: %n attribute(s) added.ERROR: %n new attribute(s) not addednot added attributes countERROR: %n new attribute(s) not addedERROR: %n new attribute(s) not addedSUCCESS: %n attribute(s) renamed.renamed attributes countSUCCESS: %n attribute(s) renamed.SUCCESS: %n attribute(s) renamed.ERROR: %n attribute(s) not renamednot renamed attributes countERROR: %n attribute(s) not renamedERROR: %n attribute(s) not renamedERROR: the count of fields is incorrect after addition/removal of fields!ERROR: the count of fields is incorrect after addition/removal of fields!ERROR: field with index %1 is not the same!ERROR: field with index %1 is not the same!Provider: %1Provider: %1Storage: %1Storage: %1expected fieldexpected fieldretrieved fieldretrieved fieldSUCCESS: %1 attribute value(s) and %2 geometries changed.SUCCESS: %1 attribute value(s) and %2 geometries changed.SUCCESS: %n attribute value(s) changed.changed attribute values countSUCCESS: %n attribute value(s) changed.SUCCESS: %n attribute value(s) changed.ERROR: %n attribute value change(s) not applied.not changed attribute values countERROR: %n attribute value change(s) not applied.ERROR: %n attribute value change(s) not applied.SUCCESS: %n feature(s) deleted.deleted features countSUCCESS: %n feature(s) deleted.SUCCESS: %n feature(s) deleted.ERROR: %n feature(s) not deleted.not deleted features countERROR: %n feature(s) not deleted.ERROR: %n feature(s) not deleted.SUCCESS: %n feature(s) added.added features countSUCCESS: %n feature(s) added.SUCCESS: %n feature(s) added.ERROR: %n feature(s) not added.not added features countERROR: %n feature(s) not added.ERROR: %n feature(s) not added.ERROR: %n feature(s) not added - provider doesn't support adding features.not added features countERROR: %n feature(s) not added - provider doesn't support adding features.ERROR: %n feature(s) not added - provider doesn't support adding features.ERROR: %n feature(s) not added - geometry type is not compatible with the current layer.not added features countERROR: %n feature(s) not added - geometry type is not compatible with the current layer.ERROR: %n feature(s) not added - geometry type is not compatible with the current layer.SUCCESS: %n geometries were changed.changed geometries countSUCCESS: %n geometries were changed.SUCCESS: %n geometries were changed.ERROR: %n geometries not changed.not changed geometries countERROR: %n geometries not changed.ERROR: %n geometries not changed.
Provider errors:
Provider errors:QgsVectorLayerExporterTaskExporting %1Exporting %1QgsVectorLayerFeatureCounterCounting features in %1Counting features in %1QgsVectorLayerLegendWidgetLegend Text FormatLegend Text FormatText FormatText FormatSet Labels from Expression…Set Labels from Expression…Text on SymbolsText on SymbolsSymbolSymbolTextTextQgsVectorLayerLoadStyleDialogLoad Layer StyleLoad Layer StyleStyles related to the layerStyles related to the layerOther styles on the databaseOther styles on the databaseCategoriesCategoriesCancelCancelDelete StyleDelete StyleLoad StyleLoad StyleLoad styleLoad styleFileFilefrom filefrom filefrom database (%1)from database (%1)QGIS Layer Style File, SLD FileQGIS Layer Style File, SLD File%1: fail. %2%1: fail. %2%1: success%1: successError occurred while retrieving styles from databaseError occurred while retrieving styles from databaseQgsVectorLayerPropertiesLayer Properties - %1Layer Properties - %1QGIS Layer Metadata FileQGIS Layer Metadata FileLoad MetadataLoad MetadataQMD FileQMD FileDefault MetadataDefault MetadataStop editing mode to enable this.Stop editing mode to enable this.MetadataMetadataLoad Metadata…Load Metadata…Save Metadata…Save Metadata…CreateCreateClearClearDeleteDeleteExportExportThis button opens the query builder and allows you to create a subset of features to display on the map canvas rather than displaying all features in the layerThis button opens the query builder and allows you to create a subset of features to display on the map canvas rather than displaying all features in the layerThe query used to limit the features in the layer is shown here. To enter or modify the query, click on the Query Builder buttonThe query used to limit the features in the layer is shown here. To enter or modify the query, click on the Query Builder buttonNot supportedNot supportedDistanceDistanceSnapToGridSnapToGridVisvalingamVisvalingamSave DependencySave DependencyThis configuration introduces a cycle in data dependencies and will be ignored.This configuration introduces a cycle in data dependencies and will be ignored.No default style was found for this layer.No default style was found for this layer.Load Layer Metadata from Metadata FileLoad Layer Metadata from Metadata FileSave Layer Metadata as QMDSave Layer Metadata as QMDSave MetadataSave MetadataLoad Styles from DatabaseLoad Styles from DatabaseSpatial IndexSpatial IndexCreation of spatial index successfulCreation of spatial index successfulCreation of spatial index failedCreation of spatial index failedLoad default style from: Load default style from: CancelCancelLocal databaseLocal databaseDatasource databaseDatasource databaseDefault StyleDefault StyleLoaded from ProviderLoaded from ProviderSave default style to: Save default style to: Are you sure you want to clear auxiliary data for %1?Are you sure you want to clear auxiliary data for %1?Are you sure you want to delete auxiliary storage for %1?Are you sure you want to delete auxiliary storage for %1?Are you sure you want to delete auxiliary field %1 for %2?Are you sure you want to delete auxiliary field %1 for %2?Load StyleLoad StyleSave as DefaultSave as DefaultStyle savedStyle savedThe retrieved style is not a valid named style. Error message: %1The retrieved style is not a valid named style. Error message: %1Save StyleSave StyleStyleStyleLoad Style…Load Style…Save Style…Save Style…Restore DefaultRestore DefaultallallQgsVectorLayerPropertiesBaseLayer PropertiesLayer PropertiesLegendLegendDescriptionDescriptionKeyword listKeyword listList of keywords separated by comma to help catalog searching.List of keywords separated by comma to help catalog searching.DataUrlDataUrlInformationInformationSourceSourceSymbologySymbology3D View3D ViewSource FieldsSource FieldsAttributes FormAttributes FormFormFormAuxiliary StorageAuxiliary StorageDependenciesDependenciesQGIS ServerQGIS ServerEdit QGIS Server settingsEdit QGIS Server settingsDigitizingDigitizingSettingsSettingsGeometry and Coordinate Reference SystemGeometry and Coordinate Reference SystemSet source coordinate reference systemSet source coordinate reference systemCreate Spatial IndexCreate Spatial IndexUpdate ExtentsUpdate ExtentsProvider Feature FilterProvider Feature FilterSettingSettingValueValueAdd new joinAdd new joinRemove selected joinRemove selected joinEdit selected joinEdit selected joinFeaturesFeaturesKeyKeyAuxiliary LayerAuxiliary LayerAdd new fieldAdd new fieldRemove selected fieldRemove selected fieldTargetTargetPropertyPropertyNameNameFull NameFull NameAuxiliary storage tables can contain additional data that should only belong to the project file. For instance, specific location or rotation for labels. Auxiliary data are saved in qgd files. New fields can be added from any data-defined widget when needed. Be aware that this information will NOT be saved in the data source but only in the project file.Auxiliary storage tables can contain additional data that should only belong to the project file. For instance, specific location or rotation for labels. Auxiliary data are saved in qgd files. New fields can be added from any data-defined widget when needed. Be aware that this information will NOT be saved in the data source but only in the project file.Lower values result in more data refreshing. Canvas updates are deferred in order to avoid refreshing multiple times if more than one layer has an auto update interval set.Lower values result in more data refreshing. Canvas updates are deferred in order to avoid refreshing multiple times if more than one layer has an auto update interval set.Automatic FixesAutomatic Fixes<html><head/><body><p>The geometry precision defines the maximum precision to of geometry coordinates that should be stored on this layer. A snap to grid algorithm will be applied on every geometry entering this layer, resulting in coordinates being rounded to multiples of this value. The operation is applied in this layer's coordinate reference system.</p></body></html><html><head/><body><p>The geometry precision defines the maximum precision to of geometry coordinates that should be stored on this layer. A snap to grid algorithm will be applied on every geometry entering this layer, resulting in coordinates being rounded to multiples of this value. The operation is applied in this layer's coordinate reference system.</p></body></html>Geometry precisionGeometry precisionRemove duplicate nodesRemove duplicate nodes[Units][Units][No precision restriction][No precision restriction]Geometry checksGeometry checksTopology checksTopology checksInserts the selected field or expression into the map tipInserts the selected field or expression into the map tipInsertInsertThe HTML map tips are shown when moving mouse over features of the currently selected layer when the 'Show Map Tips' action is toggled on. If no HTML code is set, the feature display name is used.The HTML map tips are shown when moving mouse over features of the currently selected layer when the 'Show Map Tips' action is toggled on. If no HTML code is set, the feature display name is used.Simplification threshold (higher values result in more simplification)Simplification threshold (higher values result in more simplification)Simplification algorithmSimplification algorithmMaximum scale at which the layer should be simplified (1:1 always simplifies)Maximum scale at which the layer should be simplified (1:1 always simplifies)Refresh layer at interval (seconds)Refresh layer at interval (seconds)<html><head/><body><p>Some data providers can notify QGIS (e.g. PostgreSQL) with a message. If this is the case for this layer's data provider, notification will refresh the layer. </p></body></html><html><head/><body><p>Some data providers can notify QGIS (e.g. PostgreSQL) with a message. If this is the case for this layer's data provider, notification will refresh the layer. </p></body></html>Refresh layer on notificationRefresh layer on notification<html><head/><body><p>Check if only a specific message must refresh the layer (i.e. not all data source notifications)</p></body></html><html><head/><body><p>Check if only a specific message must refresh the layer (i.e. not all data source notifications)</p></body></html>Only if message isOnly if message is<html><head/><body><p>Notification message that will refresh the layer.</p></body></html><html><head/><body><p>Notification message that will refresh the layer.</p></body></html>Features in this layer may be updated when the layers selected below are changedFeatures in this layer may be updated when the layers selected below are changedSelected dependent layers should include any layers which may externally alter the data in this layer. For instance, layers with database triggers or custom PyQGIS scripting which alter this layer should be selected. Correctly specifying dependent layers allows QGIS to invalidate caches for this layer when the dependent layers are altered.Selected dependent layers should include any layers which may externally alter the data in this layer. For instance, layers with database triggers or custom PyQGIS scripting which alter this layer should be selected. Correctly specifying dependent layers allows QGIS to invalidate caches for this layer when the dependent layers are altered.Embedded Widgets in LegendEmbedded Widgets in LegendA URL of the data presentation.A URL of the data presentation.FormatFormatShort nameShort nameAttributionAttributionAttribution's title indicates the provider of the layer.Attribution's title indicates the provider of the layer.Attribution's title indicates the provider of the data layer.Attribution's title indicates the provider of the data layer.UrlUrlAttribution's url gives a link to the webpage of the provider of the data layer.Attribution's url gives a link to the webpage of the provider of the data layer.MetadataUrlMetadataUrlThe URL of the metadata document.The URL of the metadata document.A URL of the legend image.A URL of the legend image.TypeTypeLegendUrlLegendUrlimage/pngimage/pngimage/jpegimage/jpegLabelsLabelsFieldsFieldsQuery BuilderQuery BuilderDisplayDisplayRenderingRenderingVariablesVariablesData source encodingData source encoding<b>Note:</b> Feature simplification may speed up rendering but can result in rendering inconsistencies<b>Note:</b> Feature simplification may speed up rendering but can result in rendering inconsistenciesHigher values result in more simplificationHigher values result in more simplificationpixelspixelsThis algorithm only is applied to simplify on local sideThis algorithm only is applied to simplify on local sideSimplify on provider side if possibleSimplify on provider side if possibleForce layer to render as a raster (may result in smaller export file sizes)Force layer to render as a raster (may result in smaller export file sizes)The valid attribute names for this layerThe valid attribute names for this layerThe abstract is a descriptive narrative providing more information about the layer.The abstract is a descriptive narrative providing more information about the layer.A name used to identify the layer. The short name is a text string used for machine-to-machine communication.A name used to identify the layer. The short name is a text string used for machine-to-machine communication.Layer nameLayer namedisplayed asdisplayed asMetadataMetadata<html><head/><body><p>If the remove duplicate nodes option is activated, duplicate vertices will automatically be removed from geometries which are edited on this layer.</p></body></html><html><head/><body><p>If the remove duplicate nodes option is activated, duplicate vertices will automatically be removed from geometries which are edited on this layer.</p></body></html>Display NameDisplay NameThe feature display name is used in identify results and attribute table's dual view list.The feature display name is used in identify results and attribute table's dual view list.HTML Map TipHTML Map TipScale Dependen&t VisibilityScale Dependen&t VisibilitySimplify &GeometrySimplify &GeometryData DependenciesData DependenciesTitleTitleThe title is for the benefit of humans to identify layer.The title is for the benefit of humans to identify layer.AbstractAbstractActionsActionsJoinsJoinsDiagramsDiagramsQgsVectorLayerSaveAsDialogAutomaticAutomaticNo geometryNo geometryNo symbologyNo symbologyFeature symbologyFeature symbologySymbol layer symbologySymbol layer symbologySave Layer AsSave Layer AsSave Vector Layer AsSave Vector Layer AsThe layer already exists. Do you want to overwrite the whole file or overwrite the layer?The layer already exists. Do you want to overwrite the whole file or overwrite the layer?The file already exists. Do you want to overwrite it?The file already exists. Do you want to overwrite it?The layer already exists. Do you want to overwrite the whole file, overwrite the layer or append features to the layer?The layer already exists. Do you want to overwrite the whole file, overwrite the layer or append features to the layer?The layer already exists. Do you want to overwrite the whole file or append features to the layer?The layer already exists. Do you want to overwrite the whole file or append features to the layer?The existing layer has different fields. Do you want to add the missing fields to the layer?The existing layer has different fields. Do you want to add the missing fields to the layer?<Default><Default>Overwrite fileOverwrite fileOverwrite layerOverwrite layerAppend to layerAppend to layerNameNameTypeTypeReplace with displayed valuesReplace with displayed valuesUse %1Use %1Select the coordinate reference system for the vector file. The data points will be transformed from the layer coordinate reference system.Select the coordinate reference system for the vector file. The data points will be transformed from the layer coordinate reference system.QgsVectorLayerSaveAsDialogBaseEncodingEncodingCRSCRSSave Vector Layer as...Save Vector Layer as...File nameFile nameLayer nameLayer nameSelect fields to export and their export optionsSelect fields to export and their export optionsReplace all selected raw field values by displayed valuesReplace all selected raw field values by displayed valuesSymbology exportSymbology exportGeometryGeometryGeometry typeGeometry typeForce multi-typeForce multi-typeInclude z-dimensionInclude z-dimensionExtentExtentDatasource OptionsDatasource OptionsCustom OptionsCustom OptionsLayer OptionsLayer OptionsFormatFormatSave only selected featuresSave only selected featuresSelect AllSelect AllDeselect AllDeselect AllData sourceData sourceLayerLayerAdd saved file to mapAdd saved file to mapScaleScaleQgsVectorLayerSaveStyleDialogStyle nameStyle nameDescriptionDescriptionOptionally pick an input form for attribute editing (QT Designer UI format), it will be stored in the databaseOptionally pick an input form for attribute editing (QT Designer UI format), it will be stored in the databaseUIUISave Layer StyleSave Layer StyleUse as default style for this layerUse as default style for this layerFileFileCategoriesCategoriesSave styleSave styleQGIS Layer Style File (*.qml)QGIS Layer Style File (*.qml)SLD File (*.sld)SLD File (*.sld)As QGIS QML style fileAs QGIS QML style fileAs SLD style fileAs SLD style fileIn database (%1)In database (%1)Qt Designer UI file (*.ui)Qt Designer UI file (*.ui)Attach UI FileAttach UI FileThe selected file does not appear to be a valid Qt Designer UI file.The selected file does not appear to be a valid Qt Designer UI file.QgsVectorLayerToolsOnly %1 out of %2 features were copied.Only %1 out of %2 features were copied.Some features have no geometry.Some features have no geometry.Some could not be created on the layer.Some could not be created on the layer.QgsVersionInfoConnection refused - server may be downConnection refused - server may be downThe host name %1 could not be resolved. Check your DNS settings or contact your system administrator.The host name %1 could not be resolved. Check your DNS settings or contact your system administrator.QgsVertexEditorVertex EditorVertex EditorQgsVertexEditorModelxxyyzzmmrrQgsVertexToolVertex EditorVertex EditorMoved vertexMoved vertexDeleted vertexDeleted vertexGeometry has been cleared. Use the add part tool to set geometry for this feature.Geometry has been cleared. Use the add part tool to set geometry for this feature.Validation finished (%n error(s) found).number of geometry errorsValidation finished (%n error(s) found).Validation finished (%n error(s) found).QgsVirtualLayerSourceSelectVirtual layer testVirtual layer testNo errorNo errorWarningWarningA virtual layer of this name already exists, would you like to overwrite it?A virtual layer of this name already exists, would you like to overwrite it?QgsVirtualLayerSourceSelectBaseCreate a Virtual LayerCreate a Virtual LayerLayer nameLayer nameEmbedded layersEmbedded layersEmbedded layers can be added to have SQL queries with layers that are independent from layers loaded by the current QGIS project.
In particular, saving a virtual layer with embedded layers to a QLR file can be done to reuse its definition in another project.Embedded layers can be added to have SQL queries with layers that are independent from layers loaded by the current QGIS project.
In particular, saving a virtual layer with embedded layers to a QLR file can be done to reuse its definition in another project.Local nameLocal nameProviderProviderEncodingEncodingSourceSourceAdd a new embedded layerAdd a new embedded layerAddAddImport layer definition from loaded layers of the current projectImport layer definition from loaded layers of the current projectImportImportRemove the selected embedded layerRemove the selected embedded layerRemoveRemoveQueryQuery<html><head/><body><p>This is the SQL query editor. You can edit here an SQL query referring to any existing vector layers or embedded layers.</p><p>Virtual layers rely on SQLite and SpatiaLite. Any functions from SQLite or SpatiaLite can then be used in the query. To add or access geometries of a table, you can use "tablename.geometry", regardless of original geometry column's name.</p><p><span style=" font-weight:600;">Special comments:</span></p><p>Because it is not always possible to autodetect the data type of each column in a query, special comments can be used in the query to force a specific type.</p><p>Special comments must be placed on the right of a column name and have the form <tt>/*:type*/</tt> where type can be any of <span style=" font-style:italic;">int</span>, <span style=" font-style:italic;">real</span> or <span style=" font-style:italic;">text</span>. They can also be used to specify the type and SRID of the geometry column with the following syntax: <tt>/*:gtype:srid*/</tt> where <span style=" font-style:italic;">gtype</span> can be <span style=" font-style:italic;">point</span>, <span style=" font-style:italic;">linestring</span> or <span style=" font-style:italic;">polygon</span> (with an optional <span style=" font-style:italic;">multi</span> prefix) and <span style=" font-style:italic;">srid</span> is an integer identifier.</p><p>Example:</p><p><tt>SELECT id + 1 as id /*:int*/, ST_Centroid(geometry) as geom /*:point:4326*/ FROM tab</tt></p></body></html><html><head/><body><p>This is the SQL query editor. You can edit here an SQL query referring to any existing vector layers or embedded layers.</p><p>Virtual layers rely on SQLite and SpatiaLite. Any functions from SQLite or SpatiaLite can then be used in the query. To add or access geometries of a table, you can use "tablename.geometry", regardless of original geometry column's name.</p><p><span style=" font-weight:600;">Special comments:</span></p><p>Because it is not always possible to autodetect the data type of each column in a query, special comments can be used in the query to force a specific type.</p><p>Special comments must be placed on the right of a column name and have the form <tt>/*:type*/</tt> where type can be any of <span style=" font-style:italic;">int</span>, <span style=" font-style:italic;">real</span> or <span style=" font-style:italic;">text</span>. They can also be used to specify the type and SRID of the geometry column with the following syntax: <tt>/*:gtype:srid*/</tt> where <span style=" font-style:italic;">gtype</span> can be <span style=" font-style:italic;">point</span>, <span style=" font-style:italic;">linestring</span> or <span style=" font-style:italic;">polygon</span> (with an optional <span style=" font-style:italic;">multi</span> prefix) and <span style=" font-style:italic;">srid</span> is an integer identifier.</p><p>Example:</p><p><tt>SELECT id + 1 as id /*:int*/, ST_Centroid(geometry) as geom /*:point:4326*/ FROM tab</tt></p></body></html>……Unique identifier columnUnique identifier columnGeometryGeometryAutodetectAutodetectNo geometryNo geometryGeometry columnGeometry columngeometrygeometryTypeTypePointPointLineStringLineStringPolygonPolygonMultiPointMultiPointMultiLineStringMultiLineStringMultiPolygonMultiPolygonCRSCRSTestTestQgsWCSConnectionItemEdit…Edit…DeleteDeleteQgsWCSRootItemNew Connection…New Connection…QgsWCSSourceSelectSelect a layerSelect a layerNo CRS selectedNo CRS selectedQgsWFSDescribeFeatureTypeDownload of feature type failed: %1Download of feature type failed: %1QgsWFSFeatureDownloaderLoading features for layer %1Loading features for layer %1AbortAbortQGISQGISError when parsing GetFeature responseError when parsing GetFeature responseWFSWFSServer generated an exception in GetFeature responseServer generated an exception in GetFeature responseRetrying request %1: %2/%3Retrying request %1: %2/%3Download of features failed: %1Download of features failed: %1QgsWFSFeatureHitsAsyncRequestWFSWFSDownload of feature count failed: %1Download of feature count failed: %1QgsWFSFeatureHitsRequestDownload of feature count failed: %1Download of feature count failed: %1QgsWFSNewConnectionErrorErrorCould not get capabilitiesCould not get capabilitiesNetwork ErrorNetwork ErrorCapabilities document is not validCapabilities document is not validServer ExceptionServer ExceptionQgsWFSProgressDialogHideHideQgsWFSProviderWFSWFSSyntax error.Syntax error.Missing content at end of string.Missing content at end of string.%1 is unexpected.%1 is unexpected.%1 is expected instead.%1 is expected instead.%1 or %2%1 or %2commacommaan identifieran identifierSQL query is invalid: %1SQL query is invalid: %1Typename '%1' is ambiguous without prefixTypename '%1' is ambiguous without prefixTypename '%1' is unknownTypename '%1' is unknownJOINs are not supported by this serverJOINs are not supported by this serverFROM or JOIN clause should contain the table name '%1'FROM or JOIN clause should contain the table name '%1'DescribeFeatureType failed for url %1: %2DescribeFeatureType failed for url %1: %2Analysis of DescribeFeatureType response failed for url %1, typeName %2: %3Analysis of DescribeFeatureType response failed for url %1, typeName %2: %3Column '%1' is not a direct reference to a table column.Column '%1' is not a direct reference to a table column.Field '%1': a field with the same name already exists.Field '%1': a field with the same name already exists.The geometry field of a typename that is not the main typename is ignored in the selected fields.The geometry field of a typename that is not the main typename is ignored in the selected fields.Max FeaturesMax FeaturesSupports PagingSupports PagingSupports JoinsSupports Joinsnot providednot providedsupportedsupportedunsupportedunsupportedDescribeFeatureType network request failed for url %1: %2DescribeFeatureType network request failed for url %1: %2DescribeFeatureType XML parse failed for url %1: %2DescribeFeatureType XML parse failed for url %1: %2It is probably a schema for Complex Features.It is probably a schema for Complex Features.Cannot find schema indicated in DescribeFeatureType response.Cannot find schema indicated in DescribeFeatureType response.Empty responseEmpty responseWFS service exception: %1WFS service exception: %1Unsuccessful service response: %1Unsuccessful service response: %1Unhandled response: %1Unhandled response: %1Analysis of DescribeFeatureType response failed for url %1: %2Analysis of DescribeFeatureType response failed for url %1: %2Cannot find schema root elementCannot find schema root elementCannot find element '%1'Cannot find element '%1'Cannot find ComplexType element '%1'Cannot find ComplexType element '%1'Cannot find attribute elementsCannot find attribute elementsGetCapabilities failed for url %1: %2GetCapabilities failed for url %1: %2Could not find typename %1 in capabilities for url %2Could not find typename %1 in capabilities for url %2WFS exception report (code=%1 text=%2)WFS exception report (code=%1 text=%2)missingmissingQgsWFSSharedDataSQL statement to OGC Filter error: SQL statement to OGC Filter error: Expression to OGC Filter error: Expression to OGC Filter error: Cannot create temporary SpatiaLite cacheCannot create temporary SpatiaLite cacheWFSWFSCannot connect to temporary SpatiaLite cacheCannot connect to temporary SpatiaLite cacheLayer extent reported by the server is not correct. You may need to zoom again on layer while features are being downloadedLayer extent reported by the server is not correct. You may need to zoom again on layer while features are being downloadedDownload of features for layer %1 failed or partially failed: %2. You may attempt reloading the layer with F5Download of features for layer %1 failed or partially failed: %2. You may attempt reloading the layer with F5Layer extent reported by the server is not correct. You may need to zoom on layer and then zoom out to see all featuresLayer extent reported by the server is not correct. You may need to zoom on layer and then zoom out to see all features%1: The download limit has been reached.%1: The download limit has been reached.Zoom in to fetch all data.Zoom in to fetch all data.You may want to check the 'Only request features overlapping the view extent' option to be able to zoom in to fetch all data.You may want to check the 'Only request features overlapping the view extent' option to be able to zoom in to fetch all data.QgsWFSSingleFeatureRequestDownload of feature failed: %1Download of feature failed: %1QgsWFSSourceSelect&Build query&Build queryBuild queryBuild queryNetwork ErrorNetwork ErrorCapabilities document is not validCapabilities document is not validServer ExceptionServer ExceptionErrorErrorNo LayersNo Layerscapabilities document contained no layers.capabilities document contained no layers.Create a New WFS ConnectionCreate a New WFS ConnectionModify WFS ConnectionModify WFS ConnectionLoad ConnectionsLoad ConnectionsXML files (*.xml *.XML)XML files (*.xml *.XML)Are you sure you want to remove the %1 connection and all associated settings?Are you sure you want to remove the %1 connection and all associated settings?Confirm DeleteConfirm DeleteServer exceptionServer exceptionDescribeFeatureType failedDescribeFeatureType failedQgsWFSSourceSelectBaseAdd WFS Layer from a ServerAdd WFS Layer from a ServerRemove connection to selected serviceRemove connection to selected serviceRemoveRemoveChange...Change...Display WFS FeatureTypes containing this word in the title, name or abstractDisplay WFS FeatureTypes containing this word in the title, name or abstractOnly request features overlapping the view extentOnly request features overlapping the view extentServer ConnectionsServer ConnectionsConnect to selected serviceConnect to selected serviceC&onnectC&onnectCreate a new service connectionCreate a new service connection&New&NewEdit selected service connectionEdit selected service connectionEditEditLoad connections from fileLoad connections from fileLoadLoadSave connections to fileSave connections to fileSaveSaveFilterFilterCoordinate Reference SystemCoordinate Reference SystemUse title for layer nameUse title for layer nameKeep dialog openKeep dialog openQgsWFSTransactionRequestSending of transaction failed: %1Sending of transaction failed: %1QgsWMSConnectionItemFailed to parse WMS URIFailed to parse WMS URIFailed to download capabilitiesFailed to download capabilitiesFailed to parse capabilitiesFailed to parse capabilitiesEdit…Edit…DeleteDeleteQgsWMSRootItemNew Connection…New Connection…QgsWMSSourceSelectAre you sure you want to remove the %1 connection and all associated settings?Are you sure you want to remove the %1 connection and all associated settings?Confirm DeleteConfirm DeleteLoad ConnectionsLoad ConnectionsXML files (*.xml *.XML)XML files (*.xml *.XML)Encoding %1 not supported.Encoding %1 not supported.WMS ProviderWMS ProviderFailed to parse WMS URIFailed to parse WMS URIFailed to download capabilities:
Failed to download capabilities:
The server you are trying to connect to does not seem to be a WMS server. Please check the URL.The server you are trying to connect to does not seem to be a WMS server. Please check the URL.Instead of the capabilities string that was expected, the following response has been received:
%1Instead of the capabilities string that was expected, the following response has been received:
%1Options (%n coordinate reference systems available)crs countOptions (%n coordinate reference systems available)Options (%n coordinate reference systems available)Select layer(s)Select layer(s)Select layer(s) or a tilesetSelect layer(s) or a tilesetSelect either layer(s) or a tilesetSelect either layer(s) or a tilesetCoordinate Reference System (%n available)crs countCoordinate Reference System (%n available)Coordinate Reference System (%n available)No common CRS for selected layers.No common CRS for selected layers.No CRS selectedNo CRS selectedNo image encoding selectedNo image encoding selected%n Layer(s) selectedselected layer count%n Layer(s) selected%n Layer(s) selectedTileset selectedTileset selectedCould not understand the response. The %1 provider said:
%2Could not understand the response. The %1 provider said:
%2WMS proxiesWMS proxiesSeveral WMS servers have been added to the server list. Note that if you access the internet via a web proxy, you will need to set the proxy settings in the QGIS options dialog.Several WMS servers have been added to the server list. Note that if you access the internet via a web proxy, you will need to set the proxy settings in the QGIS options dialog.parse error at row %1, column %2: %3parse error at row %1, column %2: %3network error: %1network error: %1The %1 connection already exists. Do you want to overwrite it?The %1 connection already exists. Do you want to overwrite it?Confirm OverwriteConfirm OverwriteQgsWMSSourceSelectBaseReadyReadyLayersLayersC&onnectC&onnect&New&NewEditEditAdds a few example WMS serversAdds a few example WMS serversIDIDNameNameTitleTitleAbstractAbstractSave connections to fileSave connections to fileSaveSaveLoad connections from fileLoad connections from fileLoadLoadOptionsOptionsChange...Change...Add Selected Row to WMS ListAdd Selected Row to WMS ListLayer nameLayer nameCoordinate Reference SystemCoordinate Reference SystemAdd Layer(s) from a WM(T)S ServerAdd Layer(s) from a WM(T)S ServerConnect to selected serviceConnect to selected serviceCreate a new service connectionCreate a new service connectionEdit selected service connectionEdit selected service connectionRemove connection to selected serviceRemove connection to selected serviceRemoveRemoveAdd Default ServersAdd Default ServersImage EncodingImage EncodingTile sizeTile sizeFeature limit for GetFeatureInfoFeature limit for GetFeatureInfo1010Request step sizeRequest step sizeLayer OrderLayer OrderMove selected layer UPMove selected layer UPUpUpMove selected layer DOWNMove selected layer DOWNDownDownLayerLayerStyleStyleTilesetsTilesetsFormatFormatTilesetTilesetCRSCRSServer SearchServer SearchSearchSearchDescriptionDescriptionURLURLUse contextual WMS LegendUse contextual WMS LegendQgsWcsCapabilitiesempty capabilities documentempty capabilities document
Tried URL: %1
Tried URL: %1Capabilities request redirected.Capabilities request redirected.empty of capabilities: %1empty of capabilities: %1Download of capabilities failed: %1Download of capabilities failed: %1WCSWCSDownload of capabilities failed: network request update failed for authentication configDownload of capabilities failed: network request update failed for authentication configDownload of capabilities failed: network reply update failed for authentication configDownload of capabilities failed: network reply update failed for authentication config%1 of %2 bytes of capabilities downloaded.%1 of %2 bytes of capabilities downloaded.ExceptionExceptionCould not get WCS capabilities: %1Could not get WCS capabilities: %1Dom ExceptionDom ExceptionCould not get WCS capabilities in the expected format (DTD): no %1 found.
This might be due to an incorrect WCS Server URL.
Tag: %3
Response was:
%4Could not get WCS capabilities in the expected format (DTD): no %1 found.
This might be due to an incorrect WCS Server URL.
Tag: %3
Response was:
%4Version not supportedVersion not supportedWCS server version %1 is not supported by QGIS (supported versions: 1.0.0, 1.1.0, 1.1.2)WCS server version %1 is not supported by QGIS (supported versions: 1.0.0, 1.1.0, 1.1.2)Could not get WCS capabilities: %1 at line %2 column %3
This is probably due to an incorrect WCS Server URL.
Response was:
%4Could not get WCS capabilities: %1 at line %2 column %3
This is probably due to an incorrect WCS Server URL.
Response was:
%4QgsWcsDownloadHandlerWCSWCSNetwork request update failed for authentication configNetwork request update failed for authentication configNetwork reply update failed for authentication configNetwork reply update failed for authentication configMap request error (Status: %1; Reason phrase: %2; URL: %3)Map request error (Status: %1; Reason phrase: %2; URL: %3)Map request error:<br>Title: %1<br>Error: %2<br>URL: <a href='%3'>%3</a>)Map request error:<br>Title: %1<br>Error: %2<br>URL: <a href='%3'>%3</a>)Map request error (Status: %1; Response: %2; URL: %3)Map request error (Status: %1; Response: %2; URL: %3)Map request error (Title: %1; Error: %2; URL: %3)Map request error (Title: %1; Error: %2; URL: %3)Map request error (Response: %1; URL: %2)Map request error (Response: %1; URL: %2)Map request failed [error: %1 url: %2]Map request failed [error: %1 url: %2]Cannot parse multipart response: %1Cannot parse multipart response: %1Expected 2 parts, %1 receivedExpected 2 parts, %1 receivedMore than 2 parts (%1) receivedMore than 2 parts (%1) receivedContent-Transfer-Encoding %1 not supportedContent-Transfer-Encoding %1 not supportedNot logging more than 100 request errors.Not logging more than 100 request errors.QgsWcsProviderCannot describe coverageCannot describe coverageCoverage not foundCoverage not foundCannot calculate extentCannot calculate extentCannot get test dataset.Cannot get test dataset.Received coverage has wrong extent %1 (expected %2)Received coverage has wrong extent %1 (expected %2)WCSWCSReceived coverage has wrong size %1 x %2 (expected %3 x %4)Received coverage has wrong size %1 x %2 (expected %3 x %4)Getting map via WCS.Getting map via WCS.No data receivedNo data receivedCannot create memory fileCannot create memory fileDom ExceptionDom ExceptionCould not get WCS Service Exception at %1 at line %2 column %3
Response was:
%4Could not get WCS Service Exception at %1 at line %2 column %3
Response was:
%4Service ExceptionService ExceptionRequest contains a format not offered by the server.Request contains a format not offered by the server.Request is for a Coverage not offered by the service instance.Request is for a Coverage not offered by the service instance.Value of (optional) UpdateSequence parameter in GetCapabilities request is equal to current value of service metadata update sequence number.Value of (optional) UpdateSequence parameter in GetCapabilities request is equal to current value of service metadata update sequence number.Value of (optional) UpdateSequence parameter in GetCapabilities request is greater than current value of service metadata update sequence number.Value of (optional) UpdateSequence parameter in GetCapabilities request is greater than current value of service metadata update sequence number.Request does not include a parameter value, and the server instance did not declare a default value for that dimension.Request does not include a parameter value, and the server instance did not declare a default value for that dimension.Request contains an invalid parameter value.Request contains an invalid parameter value.No other exceptionCode specified by this service and server applies to this exception.No other exceptionCode specified by this service and server applies to this exception.Operation request contains an output CRS that can not be used within the output format.Operation request contains an output CRS that can not be used within the output format.Operation request specifies to "store" the result, but not enough storage is available to do this.Operation request specifies to "store" the result, but not enough storage is available to do this.(No error code was reported)(No error code was reported)(Unknown error code)(Unknown error code)The WCS vendor also reported: The WCS vendor also reported: composed error message '%1'.composed error message '%1'.Cannot verify coverage full extent: %1Cannot verify coverage full extent: %1PropertyPropertyValueValueName (identifier)Name (identifier)TitleTitleAbstractAbstractFixed WidthFixed WidthFixed HeightFixed HeightNative CRSNative CRSNative Bounding BoxNative Bounding BoxWGS 84 Bounding BoxWGS 84 Bounding BoxAvailable in CRSAvailable in CRS(and %n more)crs(and %n more)(and %n more)Available in formatAvailable in formatWCS InfoWCS InfoCoveragesCoveragesCache StatsCache StatsServer PropertiesServer PropertiesKeywordsKeywordsOnline ResourceOnline ResourceContact PersonContact PersonFeesFeesAccess ConstraintsAccess ConstraintsImage FormatsImage FormatsGetCapabilitiesUrlGetCapabilitiesUrlGet Coverage UrlGet Coverage Url <font color="red">(advertised but ignored)</font> <font color="red">(advertised but ignored)</font>And %1 more coveragesAnd %1 more coveragesFormat not supportedFormat not supportedRead data errorRead data errorRasterIO error: RasterIO error: QgsWebPageLine %1: %2Line %1: %2JavaScriptJavaScript%1 (line %2): %3%1 (line %2): %3QgsWelcomePageRecent ProjectsRecent ProjectsThere is a new QGIS version availableThere is a new QGIS version availablePin to ListPin to ListUnpin from ListUnpin from ListOpen Directory…Open Directory…RefreshRefreshOpen “%1”…Open “%1”…Remove from ListRemove from ListQgsWfsCapabilitiesWFS version %1 not supportedWFS version %1 not supportedDownload of capabilities failed: %1Download of capabilities failed: %1QgsWfsConnectionItemEdit…Edit…DeleteDeleteModify WFS ConnectionModify WFS ConnectionQgsWfsLayerItemStylesStylesCopy StyleCopy StyleCannot copy styleCannot copy styleQgsWfsRequestWFSWFSRedirect loop detected: %1Redirect loop detected: %1empty response: %1empty response: %1network request update failed for authentication confignetwork request update failed for authentication configQgsWfsRootItemNew Connection…New Connection…Create a New WFS ConnectionCreate a New WFS ConnectionQgsWmsCapabilitiesDownload%1 of %2 bytes of capabilities downloaded.%1 of %2 bytes of capabilities downloaded.Capabilities request redirected.Capabilities request redirected.Redirect loop detected: %1Redirect loop detected: %1WMSWMSDownload of capabilities failed: network request update failed for authentication configDownload of capabilities failed: network request update failed for authentication configDownload of capabilities failed: network reply update failed for authentication configDownload of capabilities failed: network reply update failed for authentication configempty of capabilities: %1empty of capabilities: %1Download of capabilities failed: %1Download of capabilities failed: %1QgsWmsImageDownloadHandlerWMSWMSMap request error (Status: %1; Reason phrase: %2; URL: %3)Map request error (Status: %1; Reason phrase: %2; URL: %3)Returned image is flawed [Content-Type: %1; URL: %2]Returned image is flawed [Content-Type: %1; URL: %2]Map request error (Title: %1; Error: %2; URL: %3)Map request error (Title: %1; Error: %2; URL: %3)Map request error (Status: %1; Response: %2; Content-Type: %3; URL: %4)Map request error (Status: %1; Response: %2; Content-Type: %3; URL: %4)Map request failed [error: %1 url: %2]Map request failed [error: %1 url: %2]Not logging more than 100 request errors.Not logging more than 100 request errors.QgsWmsLegendDownloadHandlerRedirect loop detected: %1Redirect loop detected: %1WMSWMSGetLegendGraphic request errorGetLegendGraphic request errorStatus: %1
Reason phrase: %2Status: %1
Reason phrase: %2Returned legend image is flawed [URL: %1]Returned legend image is flawed [URL: %1]QgsWmsProviderCannot parse URICannot parse URICannot calculate extentCannot calculate extentCannot set CRSCannot set CRSNumber of layers and styles don't matchNumber of layers and styles don't matchWMSWMSNumber of tile layers must be oneNumber of tile layers must be oneTile layer not foundTile layer not foundTile layer or tile matrix set not foundTile layer or tile matrix set not foundGetting map via WMS.Getting map via WMS.Getting tiles.Getting tiles.%n tile requests in backgroundtile request count%n tile requests in background%n tile requests in background, %n cache hitstile cache hits, %n cache hits, %n cache hits, %n cache misses.tile cache missed, %n cache misses., %n cache misses., %n errors.errors, %n errors., %n errors.image is NULLimage is NULLunexpected image sizeunexpected image sizeDom ExceptionDom ExceptionService ExceptionService ExceptionRequest contains a format not offered by the server.Request contains a format not offered by the server.Request contains a CRS not offered by the server for one or more of the Layers in the request.Request contains a CRS not offered by the server for one or more of the Layers in the request.Request contains a SRS not offered by the server for one or more of the Layers in the request.Request contains a SRS not offered by the server for one or more of the Layers in the request.GetMap request is for a Layer not offered by the server, or GetFeatureInfo request is for a Layer not shown on the map.GetMap request is for a Layer not offered by the server, or GetFeatureInfo request is for a Layer not shown on the map.Request is for a Layer in a Style not offered by the server.Request is for a Layer in a Style not offered by the server.GetFeatureInfo request is applied to a Layer which is not declared queryable.GetFeatureInfo request is applied to a Layer which is not declared queryable.GetFeatureInfo request contains invalid X or Y value.GetFeatureInfo request contains invalid X or Y value.Value of (optional) UpdateSequence parameter in GetCapabilities request is equal to current value of service metadata update sequence number.Value of (optional) UpdateSequence parameter in GetCapabilities request is equal to current value of service metadata update sequence number.Value of (optional) UpdateSequence parameter in GetCapabilities request is greater than current value of service metadata update sequence number.Value of (optional) UpdateSequence parameter in GetCapabilities request is greater than current value of service metadata update sequence number.Request does not include a sample dimension value, and the server did not declare a default value for that dimension.Request does not include a sample dimension value, and the server did not declare a default value for that dimension.Request contains an invalid sample dimension value.Request contains an invalid sample dimension value.Request is for an optional operation that is not supported by the server.Request is for an optional operation that is not supported by the server.(No error code was reported)(No error code was reported)(Unknown error code)(Unknown error code)The WMS vendor also reported: The WMS vendor also reported: PropertyPropertyValueValueNameNameVisibilityVisibilityVisibleVisibleHiddenHiddenTitleTitleAbstractAbstractCan IdentifyCan IdentifyYesYesNoNoCan be TransparentCan be TransparentCan Zoom InCan Zoom InCascade CountCascade CountFixed WidthFixed WidthFixed HeightFixed HeightAvailable in CRSAvailable in CRS(and %n more)crs(and %n more)(and %n more)Available in styleAvailable in styleLegendURLsLegendURLsWMS InfoWMS InfoServer PropertiesServer PropertiesGet feature info request error (Title: %1; Error: %2; URL: %3)Get feature info request error (Title: %1; Error: %2; URL: %3)Selected LayersSelected LayersOther LayersOther LayersTile Layer PropertiesTile Layer PropertiesCache StatsCache StatsWMS VersionWMS VersionKeywordsKeywordsOnline ResourceOnline ResourceContact PersonContact PersonFeesFeesAccess ConstraintsAccess ConstraintsImage FormatsImage FormatsIdentify FormatsIdentify FormatsLayer CountLayer CountTile Layer CountTile Layer CountCould not get WMS Service Exception: %1 at line %2 column %3
Response was:
%4Could not get WMS Service Exception: %1 at line %2 column %3
Response was:
%4GetCapabilitiesUrlGetCapabilitiesUrlGetMapUrlGetMapUrl <font color="red">(advertised but ignored)</font> <font color="red">(advertised but ignored)</font>GetFeatureInfoUrlGetFeatureInfoUrlGetLegendGraphicGetLegendGraphicGetTileUrlGetTileUrlTile templatesTile templatesFeatureInfo templatesFeatureInfo templatesTileset PropertiesTileset PropertiesIdentifierIdentifierTile modeTile modeWMTSWMTSWMS-CWMS-CXYZXYZInvalid tile modeInvalid tile modeSelectedSelectedAvailable StylesAvailable StylesCRSCRSBounding BoxBounding BoxAvailable TilesetsAvailable TilesetsSelected tile matrix set Selected tile matrix set ScaleScaleTile size [px]Tile size [px]Tile size [mu]Tile size [mu]Matrix sizeMatrix sizeMatrix extent [mu]Matrix extent [mu]BoundsBoundsWidthWidthHeightHeightTopTopLeftLeftBottomBottomRightRight%n missing row(s)%n missing row(s)%n missing row(s)Layer's upper bound: %1Layer's upper bound: %1%n missing column(s)%n missing column(s)%n missing column(s)Layer's left bound: %1Layer's left bound: %1Layer's lower bound: %1Layer's lower bound: %1Layer's right bound: %1Layer's right bound: %1Cache statsCache statsHitsHitsMissesMissesErrorsErrorsFormat not supportedFormat not supportedContext not fully specified (extent was defined but width and/or height was not).Context not fully specified (extent was defined but width and/or height was not).GML schema is not validGML schema is not validGML is not validGML is not validCannot identifyCannot identifyResult parsing failed. %1 feature types were guessed from gml (%2) but no features were parsed.Result parsing failed. %1 feature types were guessed from gml (%2) but no features were parsed.identify request redirected.identify request redirected.Map getfeatureinfo error %1: %2Map getfeatureinfo error %1: %2Cannot parse getfeatureinfo: %1Cannot parse getfeatureinfo: %1Map getfeatureinfo error: %1 [%2]Map getfeatureinfo error: %1 [%2]%1 of %2 bytes of GetLegendGraphic downloaded.%1 of %2 bytes of GetLegendGraphic downloaded.QgsWmsTiledImageDownloadHandlerTile request errorTile request errorStatus: %1
Reason phrase: %2Status: %1
Reason phrase: %2WMSWMSTile request error (Title: %1; Error: %2; URL: %3)Tile request error (Title: %1; Error: %2; URL: %3)Tile request error (Status: %1; Content-Type: %2; Length: %3; URL: %4)Tile request error (Status: %1; Content-Type: %2; Length: %3; URL: %4)Returned image is flawed [Content-Type: %1; URL: %2]Returned image is flawed [Content-Type: %1; URL: %2]%n tile requests in backgroundtile request count%n tile requests in background%n tile requests in background, %n cache hitstile cache hits, %n cache hits, %n cache hits, %n cache misses.tile cache missed, %n cache misses., %n cache misses., %n errors.errors, %n errors., %n errors.Not logging more than 100 request errors.Not logging more than 100 request errors.Tile request max retry error. Failed %1 requests for tile %2 of tileRequest %3 (url: %4)Tile request max retry error. Failed %1 requests for tile %2 of tileRequest %3 (url: %4)repeat tileRequest %1 tile %2(retry %3)repeat tileRequest %1 tile %2(retry %3)QgsWmtsDimensionsBaseSelect DimensionsSelect DimensionsDimensionDimensionValueValueAbstractAbstractDefaultDefaultQgsXyzConnectionDialogXYZ ConnectionXYZ ConnectionConnection DetailsConnection DetailsRefererRefererOptional custom refererOptional custom refererMax. Zoom LevelMax. Zoom LevelURL of the connection, {z}, {y}, and {z} will be replaced with actual values. Use {-y} for inverted y axis.URL of the connection, {z}, {y}, and {z} will be replaced with actual values. Use {-y} for inverted y axis.http://example.com/{z}/{x}/{y}.pnghttp://example.com/{z}/{x}/{y}.pngNameNameName of the new connectionName of the new connectionAuthenticationAuthenticationURLURLMin. Zoom LevelMin. Zoom LevelQgsXyzLayerItemEdit…Edit…DeleteDeleteQgsXyzTileRootItemNew Connection…New Connection…Save Connections…Save Connections…Load Connections…Load Connections…Load ConnectionsLoad ConnectionsXML files (*.xml *.XML)XML files (*.xml *.XML)RandomExtractVector selectionVector selectionNumber of selected featuresNumber of selected featuresPercentage of selected featuresPercentage of selected featuresInput layerInput layerMethodMethodNumber/percentage of selected featuresNumber/percentage of selected featuresExtracted (random)Extracted (random)Selected number is greater than feature count. Choose a lower value and try again.Selected number is greater than feature count. Choose a lower value and try again.Percentage can't be greater than 100. Set a different value and try again.Percentage can't be greater than 100. Set a different value and try again.Random extractRandom extractRandomExtractWithinSubsetsVector selectionVector selectionNumber of selected featuresNumber of selected featuresPercentage of selected featuresPercentage of selected featuresInput layerInput layerID fieldID fieldMethodMethodNumber/percentage of selected featuresNumber/percentage of selected featuresExtracted (random stratified)Extracted (random stratified)Selected number is greater that feature count. Choose lesser value and try again.Selected number is greater that feature count. Choose lesser value and try again.Percentage can't be greater than 100. Set correct value and try again.Percentage can't be greater than 100. Set correct value and try again.Subset "{}" is smaller than requested number of features.Subset "{}" is smaller than requested number of features.Random extract within subsetsRandom extract within subsetsRandomPointsAlongLinesVector creationVector creationInput layerInput layerNumber of pointsNumber of pointsMinimum distance between pointsMinimum distance between pointsCould not generate requested number of random points. Maximum number of attempts exceeded.Could not generate requested number of random points. Maximum number of attempts exceeded.Random pointsRandom pointsRandom points along lineRandom points along lineRandomPointsExtentVector creationVector creationInput extentInput extentNumber of pointsNumber of pointsMinimum distance between pointsMinimum distance between pointsTarget CRSTarget CRSCould not generate requested number of random points. Maximum number of attempts exceeded.Could not generate requested number of random points. Maximum number of attempts exceeded.Random pointsRandom pointsRandom points in extentRandom points in extentRandomPointsLayerVector creationVector creationInput layerInput layerNumber of pointsNumber of pointsMinimum distance between pointsMinimum distance between pointsCould not generate requested number of random points. Maximum number of attempts exceeded.Could not generate requested number of random points. Maximum number of attempts exceeded.Random pointsRandom pointsRandom points in layer boundsRandom points in layer boundsRandomPointsPolygonsVector creationVector creationPoints countPoints countPoints densityPoints densityInput layerInput layerSampling strategySampling strategyExpressionExpressionMinimum distance between pointsMinimum distance between pointsRandom pointsRandom pointsRandom points inside polygonsRandom points inside polygonsEvaluation error for feature ID {}: {}Evaluation error for feature ID {}: {}Could not generate requested number of random points. Maximum number of attempts exceeded.Could not generate requested number of random points. Maximum number of attempts exceeded.RandomSelectionVector selectionVector selectionNumber of selected featuresNumber of selected featuresPercentage of selected featuresPercentage of selected featuresInput layerInput layerMethodMethodNumber/percentage of selected featuresNumber/percentage of selected featuresSelected (random)Selected (random)Selected number is greater than feature count. Choose a lower value and try again.Selected number is greater than feature count. Choose a lower value and try again.Percentage can't be greater than 100. Set a different value and try again.Percentage can't be greater than 100. Set a different value and try again.Random selectionRandom selectionRandomSelectionWithinSubsetsVector selectionVector selectionNumber of selected featuresNumber of selected featuresPercentage of selected featuresPercentage of selected featuresInput layerInput layerID fieldID fieldSelected (stratified random)Selected (stratified random)Subset "{}" is smaller than requested number of features.Subset "{}" is smaller than requested number of features.MethodMethodNumber/percentage of selected featuresNumber/percentage of selected featuresSelected number is greater that feature count. Choose lesser value and try again.Selected number is greater that feature count. Choose lesser value and try again.Percentage can't be greater than 100. Set a different value and try again.Percentage can't be greater than 100. Set a different value and try again.Random selection within subsetsRandom selection within subsetsRasterCalculatorRaster analysisRaster analysisRasterLayerHistogramGraphicsGraphicsInput layerInput layerBand numberBand numbernumber of binsnumber of binsHTML files (*.html)HTML files (*.html)HistogramHistogramRaster layer histogramRaster layer histogramRasterLayerStatisticsRaster analysisRaster analysisInput layerInput layerBand numberBand numberStatisticsStatisticsHTML files (*.html)HTML files (*.html)Minimum valueMinimum valueMaximum valueMaximum valueRangeRangeSumSumMean valueMean valueAnalyzed file: {} (band {})Analyzed file: {} (band {})Minimum value: {}Minimum value: {}Maximum value: {}Maximum value: {}Range: {}Range: {}Sum: {}Sum: {}Mean value: {}Mean value: {}Standard deviation: {}Standard deviation: {}Sum of the squares: {}Sum of the squares: {}Standard deviationStandard deviationSum of the squaresSum of the squaresRaster layer statisticsRaster layer statisticsRasterSamplingSample raster valuesSample raster valuesRaster analysisRaster analysisInput Point LayerInput Point LayerRaster Layer to sampleRaster Layer to sampleOutput column prefixOutput column prefixSampled PointsSampled PointsImpossible to sample data of multipart feature {}.Impossible to sample data of multipart feature {}.Could not reproject feature {} to raster CRSCould not reproject feature {} to raster CRSRasterizeAlgorithmMinimum extent to renderMinimum extent to renderTile sizeTile sizeMap units per pixelMap units per pixelMake background transparentMake background transparentMap theme to renderMap theme to renderSingle layer to renderSingle layer to renderOutput layerOutput layerConvert map to rasterConvert map to rasterRaster toolsRaster toolslayer,raster,convert,file,map themes,tiles,renderlayer,raster,convert,file,map themes,tiles,renderRecordDialogRecord MetadataRecord MetadataRectanglesOvalsDiamondsFixedRectangles, ovals, diamonds (fixed)Rectangles, ovals, diamonds (fixed)Vector geometryVector geometryRectanglesRectanglesDiamondsDiamondsOvalsOvalsInput layerInput layerBuffer shapeBuffer shapeWidthWidthHeightHeightRotationRotationNumber of segmentsNumber of segmentsOutputOutputRectanglesOvalsDiamondsVariableRectangles, ovals, diamonds (variable)Rectangles, ovals, diamonds (variable)Vector geometryVector geometryRectanglesRectanglesDiamondsDiamondsOvalsOvalsInput layerInput layerBuffer shapeBuffer shapeWidth fieldWidth fieldHeight fieldHeight fieldRotation fieldRotation fieldNumber of segmentsNumber of segmentsOutputOutputFeature {} has empty angle. Skipping…Feature {} has empty angle. Skipping…Feature {} has empty width or height. Skipping…Feature {} has empty width or height. Skipping…RegularPointsVector creationVector creationInput extentInput extentPoint spacing/countPoint spacing/countInitial inset from corner (LH side)Initial inset from corner (LH side)Apply random offset to point spacingApply random offset to point spacingUse point spacingUse point spacingOutput layer CRSOutput layer CRSRegular pointsRegular pointsReliefRaster terrain analysisRaster terrain analysisElevation layerElevation layerZ factorZ factorGenerate relief classes automaticallyGenerate relief classes automaticallyRelief colorsRelief colorsReliefReliefFrequency distributionFrequency distributionSpecify relief colors or activate "Generate relief classes automatically" option.Specify relief colors or activate "Generate relief classes automatically" option.ReliefColorsWidgetImport Colors and elevations from XMLImport Colors and elevations from XMLXML files (*.xml *.XML)XML files (*.xml *.XML)Error parsing XMLError parsing XMLThe XML file could not be loadedThe XML file could not be loadedExport Colors and elevations as XMLExport Colors and elevations as XMLEnter lower elevation class boundEnter lower elevation class boundElevationElevationEnter upper elevation class boundEnter upper elevation class boundSelect color for relief classSelect color for relief classRenderingStyleFilePanelSelect Style FileSelect Style FileQGIS Layer Style File (*.qml *.QML)QGIS Layer Style File (*.qml *.QML)RuggednessRaster terrain analysisRaster terrain analysisElevation layerElevation layerZ factorZ factorRuggednessRuggednessRuggedness indexRuggedness indexSLDatabaseRun &VacuumRun &Vacuum&Database&DatabaseNo database selected or you are not connected to it.No database selected or you are not connected to it.SagaAlgorithmUnsupported file formatUnsupported file formatSAGA execution commandsSAGA execution commandsProcessingProcessingInput layer {0} has more than one band.
Multiband layers are not supported by SAGAInput layer {0} has more than one band.
Multiband layers are not supported by SAGAInput layers do not have the same grid extent.Input layers do not have the same grid extent.SagaAlgorithmProviderEnable SAGA Import/Export optimizationsEnable SAGA Import/Export optimizationsLog execution commandsLog execution commandsLog console outputLog console outputProcessingProcessingProblem with SAGA installation: unsupported SAGA version (found: {}, required: {}).Problem with SAGA installation: unsupported SAGA version (found: {}, required: {}).Could not open SAGA algorithm: {}Could not open SAGA algorithm: {}Could not open SAGA algorithm: {}
{}Could not open SAGA algorithm: {}
{}ActivateActivateProblem with SAGA installation: SAGA was not found or is not correctly installedProblem with SAGA installation: SAGA was not found or is not correctly installedSagaUtilsSAGA execution console outputSAGA execution console outputScriptAlgorithmProviderScripts folder(s)Scripts folder(s)ScriptsScriptsScriptEditorDialogUntitled ScriptUntitled Script{} - Processing Script Editor{} - Processing Script EditorSave Script?Save Script?There are unsaved changes in this script. Do you want to keep those?There are unsaved changes in this script. Do you want to keep those?There are unsaved changes in the script. Continue?There are unsaved changes in the script. Continue?Open scriptOpen scriptProcessing scripts (*.py *.PY)Processing scripts (*.py *.PY)Save scriptSave scriptI/O errorI/O errorUnable to save edits:
{}Unable to save edits:
{}Execution errorExecution errorNo script foundNo script foundSeems there is no valid script in the file.Seems there is no valid script in the file.Unsaved changesUnsaved changesScriptUtilsCould not import script algorithm '{}' from '{}'
{}Could not import script algorithm '{}' from '{}'
{}ProcessingProcessingSearchBarSearch BarSearch BarXXFind:Find:<<>>……Match caseMatch caseRegular expressionRegular expressionHighlight all matchesHighlight all matchesSelectByAttributecontainscontainsselect,attribute,value,contains,null,fieldselect,attribute,value,contains,null,fieldVector selectionVector selectionbegins withbegins withis nullis nullis not nullis not nulldoes not containdoes not containcreating new selectioncreating new selectionadding to current selectionadding to current selectionremoving from current selectionremoving from current selectionselecting within current selectionselecting within current selectionInput layerInput layerSelection attributeSelection attributeOperatorOperatorValueValueModify current selection byModify current selection bySelected (attribute)Selected (attribute)Field '{}' was not found in layerField '{}' was not found in layerOperators {0} can be used only with string fields.Operators {0} can be used only with string fields.Select by attributeSelect by attributeSelectByExpressionVector selectionVector selectioncreating new selectioncreating new selectionadding to current selectionadding to current selectionremoving from current selectionremoving from current selectionselecting within current selectionselecting within current selectionInput layerInput layerSelected (attribute)Selected (attribute)ExpressionExpressionModify current selection byModify current selection bySelect by expressionSelect by expressionServiceAreaFromLayerNetwork analysisNetwork analysisForward directionForward directionBackward directionBackward directionBoth directionsBoth directionsShortestShortestFastestFastestVector layer representing networkVector layer representing networkVector layer with start pointsVector layer with start pointsPath type to calculatePath type to calculateTravel cost (distance for "Shortest", time for "Fastest")Travel cost (distance for "Shortest", time for "Fastest")Direction fieldDirection fieldValue for forward directionValue for forward directionValue for backward directionValue for backward directionValue for both directionsValue for both directionsDefault directionDefault directionSpeed fieldSpeed fieldDefault speed (km/h)Default speed (km/h)Topology toleranceTopology toleranceInclude upper/lower bound pointsInclude upper/lower bound pointsService area (lines)Service area (lines)Service area (boundary nodes)Service area (boundary nodes)Service area (from layer)Service area (from layer)Loading start points…Loading start points…Building graph…Building graph…Calculating service areas…Calculating service areas…ServiceAreaFromPointNetwork analysisNetwork analysisForward directionForward directionBackward directionBackward directionBoth directionsBoth directionsShortestShortestFastestFastestVector layer representing networkVector layer representing networkStart pointStart pointPath type to calculatePath type to calculateTravel cost (distance for "Shortest", time for "Fastest")Travel cost (distance for "Shortest", time for "Fastest")Direction fieldDirection fieldValue for forward directionValue for forward directionValue for backward directionValue for backward directionValue for both directionsValue for both directionsDefault directionDefault directionSpeed fieldSpeed fieldDefault speed (km/h)Default speed (km/h)Topology toleranceTopology toleranceInclude upper/lower bound pointsInclude upper/lower bound pointsService area (lines)Service area (lines)Service area (boundary nodes)Service area (boundary nodes)Service area (from point)Service area (from point)Building graph…Building graph…Calculating service area…Calculating service area…Writing results…Writing results…SetMValueVector geometryVector geometrySet M valueSet M valueM AddedM Addedset,add,m,measure,valuesset,add,m,measure,valuesM ValueM ValueSetRasterStyleRaster toolsRaster toolsRaster layerRaster layerStyle fileStyle fileStyledStyledSet style for raster layerSet style for raster layerSetVectorStyleVector generalVector generalVector layerVector layerStyle fileStyle fileStyledStyledSet style for vector layerSet style for vector layerSetZValueVector geometryVector geometrySet Z valueSet Z valueZ AddedZ Addedset,add,z,25d,3d,valuesset,add,z,25d,3d,valuesZ ValueZ ValueSettingWrong parameter value:
{0}Wrong parameter value:
{0}Specified path does not exist:
{0}Specified path does not exist:
{0}SettingsDialogPythonConsoleEditorEditorAuto-save script before runningAuto-save script before runningFont and ColorsFont and ColorsReset to default colorsReset to default colorsTypingTypingAutomatic insertion of the 'import' string on 'from xxx'Automatic insertion of the 'import' string on 'from xxx'AutocompletionAutocompletionGet autocompletion from current documentGet autocompletion from current documentGet autocompletion from current document and installed APIsGet autocompletion from current document and installed APIsGet autocompletion from installed APIsGet autocompletion from installed APIsAutocompletion thresholdAutocompletion thresholdAutomatic parentheses insertionAutomatic parentheses insertionFontFontSizeSizeEnable Object Inspector (switching between tabs may be slow)Enable Object Inspector (switching between tabs may be slow)ConsoleConsoleConsole settingsConsole settingsEditor settingsEditor settingsAPIsAPIs APIs file settings for autocompletion APIs file settings for autocompletionDefaultDefaultKeywordKeywordClass nameClass nameFunctionFunctionDecoratorDecoratorNumberNumberCommentCommentComment blockComment blockCursorCursorCaretlineCaretlineSingle quoteSingle quoteDouble quoteDouble quoteTriple single quoteTriple single quoteTriple double quoteTriple double quoteBackgroundBackgroundMargin backgroundMargin backgroundMargin foregroundMargin foregroundErrorErrorSelection backgroundSelection backgroundSelection foregroundSelection foregroundBrace backgroundBrace backgroundBrace foregroundBrace foregroundcharacterscharactersFrom doc and APIsFrom doc and APIsFrom API filesFrom API filesFrom documentFrom documentRun and DebugRun and DebugEdgeEdgeFold guideFold guideUsing preloaded APIs fileUsing preloaded APIs filePathPathUsing prepared APIs fileUsing prepared APIs fileCompile APIs...Compile APIs...Python Console SettingsPython Console SettingsShowTestDialogUnit TestUnit TestSimplifyUserInputWidgetBaseSimplification ToolSimplification ToolMethodMethodToleranceToleranceIterationsIterationsNumber of smooth iterations. More iterations results in smoother geometries, at the expense of greatly increasing the number of vertices in those geometries.Number of smooth iterations. More iterations results in smoother geometries, at the expense of greatly increasing the number of vertices in those geometries.OffsetOffsetOffset from existing vertices at which to insert smoothed vertices. Larger values result in "looser" smoothing, smaller values result in "tight" smoothing.Offset from existing vertices at which to insert smoothed vertices. Larger values result in "looser" smoothing, smaller values result in "tight" smoothing. % %SingleSidedBufferVector geometryVector geometryLeftLeftRoundRoundDistanceDistanceSideSideSegmentsSegmentsJoin styleJoin styleMiter limitMiter limitSingle sided bufferSingle sided bufferBufferBufferError calculating single sided bufferError calculating single sided bufferSlopeRaster terrain analysisRaster terrain analysisElevation layerElevation layerZ factorZ factorSlopeSlopeSnapGeometriesToLayerVector geometryVector geometryInput layerInput layerReference layerReference layerToleranceTolerancePrefer aligning nodes, insert extra vertices where requiredPrefer aligning nodes, insert extra vertices where requiredPrefer closest point, insert extra vertices where requiredPrefer closest point, insert extra vertices where requiredPrefer aligning nodes, don't insert new verticesPrefer aligning nodes, don't insert new verticesPrefer closest point, don't insert new verticesPrefer closest point, don't insert new verticesMove end points only, prefer aligning nodesMove end points only, prefer aligning nodesMove end points only, prefer closest pointMove end points only, prefer closest pointSnap end points to end points onlySnap end points to end points onlySnap to anchor nodes (single layer only)Snap to anchor nodes (single layer only)BehaviorBehaviorSnapped geometrySnapped geometrySnap geometries to layerSnap geometries to layerThis mode applies when the input and reference layer are the same.This mode applies when the input and reference layer are the same.Snapped {} geometries.Snapped {} geometries.SpatiaLiteDBPluginThere is no defined database connection "{0}".There is no defined database connection "{0}".SpatialIndexCreate spatial indexCreate spatial indexVector generalVector generalInput LayerInput LayerIndexed layerIndexed layerCould not create spatial indexCould not create spatial indexLayer's data provider does not support spatial indexesLayer's data provider does not support spatial indexesSpatialJoinGeometric predicateGeometric predicateVector generalVector generalintersectsintersectscontainscontainsequalsequalstouchestouchesoverlapsoverlapswithinwithincrossescrossesCreate separate feature for each located feature (one-to-many)Create separate feature for each located feature (one-to-many)Take attributes of the first located feature only (one-to-one)Take attributes of the first located feature only (one-to-one)Input layerInput layerJoin layerJoin layerFields to add (leave empty to use all fields)Fields to add (leave empty to use all fields)Join typeJoin typeDiscard records which could not be joinedDiscard records which could not be joinedJoined field prefixJoined field prefixJoined layerJoined layerUnjoinable features from first layerUnjoinable features from first layerNumber of joined features from input tableNumber of joined features from input tableJoin attributes by locationJoin attributes by locationjoin,intersects,intersecting,touching,within,contains,overlaps,relation,spatialjoin,intersects,intersecting,touching,within,contains,overlaps,relation,spatialSpatialJoinSummaryVector generalVector generalintersectsintersectscontainscontainsequalsequalstouchestouchesoverlapsoverlapswithinwithincrossescrossescountcountuniqueuniqueminminmaxmaxrangerangesumsummeanmeanmedianmedianstddevstddevminorityminoritymajoritymajorityq1q1q3q3iqriqremptyemptyfilledfilledmin_lengthmin_lengthmax_lengthmax_lengthmean_lengthmean_lengthInput layerInput layerJoin layerJoin layerGeometric predicateGeometric predicateFields to summarise (leave empty to use all fields)Fields to summarise (leave empty to use all fields)Summaries to calculate (leave empty to use all available)Summaries to calculate (leave empty to use all available)Discard records which could not be joinedDiscard records which could not be joinedJoined layerJoined layerJoin attributes by location (summary)Join attributes by location (summary)summary,aggregate,join,intersects,intersecting,touching,within,contains,overlaps,relation,spatial,stats,statistics,sum,maximum,minimum,mean,average,standard,deviation,count,distinct,unique,variance,median,quartile,range,majority,minority,histogram,distinctsummary,aggregate,join,intersects,intersecting,touching,within,contains,overlaps,relation,spatial,stats,statistics,sum,maximum,minimum,mean,average,standard,deviation,count,distinct,unique,variance,median,quartile,range,majority,minority,histogram,distinctSpatialiteExecuteSQLDatabaseDatabaseFile DatabaseFile DatabaseSQL querySQL querySpatiaLite execute SQLSpatiaLite execute SQLExecutes a SQL command on a SpatiaLite databaseExecutes a SQL command on a SpatiaLite databaseError executing SQL:
{0}Error executing SQL:
{0}SplitRGBBandsSplit RGB bandsSplit RGB bandsImage toolsImage toolsInput layerInput layerOutput R band layerOutput R band layerOutput G band layerOutput G band layerOutput B band layerOutput B band layerSslErrorsUnable to Validate the ConnectionUnable to Validate the Connection<html><head/><body><p><span style=" font-family:'Sans Serif'; font-size:11pt; font-weight:600; color:#ff0000;">Warning</span><span style=" font-family:'Sans Serif'; font-size:11pt; color:#ff0000;">:</span><span style=" font-family:'Sans Serif'; font-size:8pt; color:#000000;"> One or more SSL errors have occurred validating the host you are connecting to. Review the following list of errors and click Ignore to continue, or Cancel to abort the connection.</span></p></body></html><html><head/><body><p><span style=" font-family:'Sans Serif'; font-size:11pt; font-weight:600; color:#ff0000;">Warning</span><span style=" font-family:'Sans Serif'; font-size:11pt; color:#ff0000;">:</span><span style=" font-family:'Sans Serif'; font-size:11pt; color:#000000;"> One or more SSL errors have occurred validating the host you are connecting to. Review the following list of errors and click Ignore to continue, or Cancel to abort the connection.</span></p></body></html> {11p?} {600;?} {0000;?} {11p?} {0000;?} {8p?} {000000;?} {11p or 8p?} {11p or 8p?}View Certificate ChainView Certificate ChainIgnoreIgnoreCancelCancelStatisticsByCategoriesInput vector layerInput vector layerVector analysisVector analysisgroups,stats,statistics,table,layer,sum,maximum,minimum,mean,average,standard,deviation,count,distinct,unique,variance,median,quartile,range,majority,minority,histogram,distinct,summarygroups,stats,statistics,table,layer,sum,maximum,minimum,mean,average,standard,deviation,count,distinct,unique,variance,median,quartile,range,majority,minority,histogram,distinct,summaryField to calculate statistics on (if empty, only count is calculated)Field to calculate statistics on (if empty, only count is calculated)Field(s) with categoriesField(s) with categoriesStatistics by categoryStatistics by categoryStatistics by categoriesStatistics by categoriesStringWidgetWrapperExpression based inputExpression based inputSumLinesVector analysisVector analysisLinesLinesPolygonsPolygonsLines length field nameLines length field nameLines count field nameLines count field nameLine lengthLine lengthSum line lengthsSum line lengthsSymbolLayerItemMarkerMarkerFillFillLineLineSymbolsGroupSelectionDialogBaseGroup Selection DialogGroup Selection DialogCloseCloseSymbolsListWidgetFormFormOpen Library…Open Library…Save SymbolSave SymbolUnitUnitOpacityOpacityFilter SymbolsFilter SymbolsStyle ManagerStyle ManagerIcon ViewIcon ViewPushButtonPushButtonList ViewList ViewColorColorSizeSizeRotationRotationWidthWidthSymbol NameSymbol NameSave symbolSave symbolAdvancedAdvanced…… ° °TableFieldWidgetWrapperInput parameter, or name of field (separate field names with ; for multiple field parameters)Input parameter, or name of field (separate field names with ; for multiple field parameters)TextToFloatVector tableVector tableText attribute to convert to floatText attribute to convert to floatFloat from textFloat from textText to floatText to floatTinInterpolationInterpolationInterpolationLinearLinearClough-Toucher (cubic)Clough-Toucher (cubic)Input layer(s)Input layer(s)Interpolation methodInterpolation methodNumber of columnsNumber of columnsNumber of rowsNumber of rowsExtentExtentInterpolatedInterpolatedTriangulationTriangulationTIN interpolationTIN interpolationYou need to specify at least one input layer.You need to specify at least one input layer.TopoColortopocolor,colors,graph,adjacent,assigntopocolor,colors,graph,adjacent,assignCartographyCartographyInput layerInput layerMinimum number of colorsMinimum number of colorsMinimum distance between featuresMinimum distance between featuresBy feature countBy feature countBy assigned areaBy assigned areaBy distance between colorsBy distance between colorsBalance color assignmentBalance color assignmentColoredColoredTopological coloringTopological coloring{} colors required{} colors requiredTopolTopology Checker for vector layerTopology Checker for vector layerTruncateTableempty,delete,layer,clear,featuresempty,delete,layer,clear,featuresVector generalVector generalInput LayerInput LayerTruncated layerTruncated layerTruncate tableTruncate tableCould not truncate table.Could not truncate table.UndoWidgetUndo/RedoUndo/RedoUndoUndoRedoRedoUniqueValuesInput layerInput layerVector analysisVector analysisTarget field(s)Target field(s)Unique valuesUnique valuesHTML reportHTML reportHTML files (*.html)HTML files (*.html)Total unique valuesTotal unique valuesInvalid field name {}Invalid field name {}<p>Total unique values: <p>Total unique values: <p>Unique values:</p><p>Unique values:</p>List unique valuesList unique valuesUserExpressionsUser expressionsUser expressionsThe user expression {0} is not validThe user expression {0} is not validVariableDistanceBufferVector geometryVector geometryInput layerInput layerDistance fieldDistance fieldSegmentsSegmentsDissolve resultDissolve resultRoundRoundEnd cap styleEnd cap styleJoin styleJoin styleMiter limitMiter limitBufferBufferVariable distance bufferVariable distance bufferVariableEditorDelegateA variable with the name "%1" already exists in this context.A variable with the name "%1" already exists in this context.Rename VariableRename VariableVectorLayerHistogramGraphicsGraphicsInput layerInput layerAttributeAttributenumber of binsnumber of binsHistogramHistogramHTML files (*.html)HTML files (*.html)Vector layer histogramVector layer histogramVectorLayerScatterplotGraphicsGraphicsInput layerInput layerX attributeX attributeY attributeY attributeScatterplotScatterplotHTML files (*.html)HTML files (*.html)Vector layer scatterplotVector layer scatterplotVectorLayerScatterplot3DGraphicsGraphicsInput layerInput layerX attributeX attributeY attributeY attributeZ attributeZ attributeHistogramHistogramHTML files (*.html)HTML files (*.html)Vector layer scatterplot 3DVector layer scatterplot 3DVectorLayerWidgetWrapperSelect fileSelect fileVectorSplitVector generalVector generalInput layerInput layerUnique ID fieldUnique ID fieldOutput directoryOutput directoryOutput layersOutput layersSplit vector layerSplit vector layerCreating layer: {}Creating layer: {}Added {} features to layerAdded {} features to layerVoronoiPolygonsVector geometryVector geometryInput layerInput layerBuffer region (% of extent)Buffer region (% of extent)Voronoi polygonsVoronoi polygonsThere were no polygons created.There were no polygons created.Input file should contain at least 3 points. Choose another file and try again.Input file should contain at least 3 points. Choose another file and try again.WidgetBlurFormFormOpacityOpacityBlend modeBlend modeBlur typeBlur typeBlur strengthBlur strengthDraw modeDraw modeWidgetCentroidFillFormFormForce point inside polygonForce point inside polygonDraw point on every part of multi-part featuresDraw point on every part of multi-part featuresWhen unchecked, a single point will be drawn on the biggest part of multi-part featuresWhen unchecked, a single point will be drawn on the biggest part of multi-part featuresWidgetColorEffectFormFormColorizeColorizeContrastContrastBrightnessBrightnessSaturationSaturation%%OpacityOpacityBlend modeBlend modeDraw modeDraw modeGrayscaleGrayscaleWidgetDrawSourceFormFormBlend modeBlend modeOpacityOpacityDraw modeDraw modeWidgetEllipseBaseFormFormLeftLeftHCenterHCenterRightRightxxyyTopTopVCenterVCenterBottomBottom……Fill colorFill colorStroke styleStroke styleStroke colorStroke colorStroke widthStroke widthHairlineHairlineJoin styleJoin styleRotationRotationAnchor pointAnchor pointSymbol widthSymbol widthSymbol heightSymbol heightOffsetOffset ° °WidgetFilledMarkerFormFormSizeSizeRotationRotation ° °……OffsetOffsetyyxxAnchor pointAnchor pointLeftLeftHCenterHCenterRightRightTopTopVCenterVCenterBottomBottomWidgetFontMarkerFormFormJoin styleJoin styleRotationRotationAnchor pointAnchor point……OffsetOffsetxxyyFill colorFill colorStroke colorStroke colorLeftLeftHCenterHCenterRightRightTopTopVCenterVCenterBottomBottomStroke widthStroke widthNo strokeNo strokeSizeSizeFont familyFont family ° °WidgetGlowFormFormColor rampColor rampSpreadSpreadBlur radiusBlur radiusOpacityOpacitySingle colorSingle colorBlend modeBlend modeDraw modeDraw modeWidgetGradientFillFormFormTwo colorTwo colorColor rampColor rampGradient typeGradient typeLinearLinearRadialRadialConicalConicalCoord modeCoord modeObjectObject……OffsetOffsetViewportViewportReference point 2Reference point 2SpreadSpreadReference point 1Reference point 1RotationRotationPadPadRepeatRepeatReflectReflectxxyy ° °CentroidCentroidWidgetLinePatternFillFormForm……SpacingSpacingOffsetOffset ° °RotationRotationWidgetMarkerLineFormForm……Marker placementMarker placementwith intervalwith intervalon every vertexon every vertexon last vertex onlyon last vertex onlyon first vertex onlyon first vertex onlyOffset along lineOffset along lineon every curve pointon every curve pointRotate markerRotate markerLine offsetLine offseton central pointon central pointWidgetPointPatternFillFormFormDistanceDistanceDisplacementDisplacementHorizontalHorizontal……VerticalVerticalWidgetRasterFillFormForm……xxyyImage widthImage widthCoord modeCoord modeObjectObjectViewportViewportOffsetOffsetRotationRotationOriginalOriginalOpacityOpacity ° °WidgetSVGFillFormForm……Stroke colorStroke colorNo strokeNo strokeStroke widthStroke widthFill colorFill colorRotationRotationTexture widthTexture widthSVG GroupsSVG GroupsSVG SymbolsSVG Symbols ° °WidgetShadowEffectFormFormColorColorOpacityOpacityOffsetOffsetBlend modeBlend modeBlur radiusBlur radius˚˚Draw modeDraw modeWidgetShapeburstFillFormForm……Two colorTwo colorGradient ColorsGradient ColorsSet distanceSet distanceOffsetOffsetColor rampColor rampxxyyWhole shapeWhole shapeShading StyleShading StyleIgnore rings in polygons while shadingIgnore rings in polygons while shadingBlur strengthBlur strengthWidgetSimpleFillFormFormHairlineHairlineFill styleFill styleOffsetOffset……Stroke colorStroke colorxxyyJoin styleJoin styleStroke styleStroke styleFill colorFill colorStroke widthStroke widthWidgetSimpleLineFormForm……ColorColorChangeChangeHairlineHairlineOffsetOffsetJoin styleJoin styleCap styleCap styleStroke widthStroke widthStroke styleStroke styleUse custom dash patternUse custom dash patternDraw line only inside polygonDraw line only inside polygonWidgetSimpleMarkerFormFormRotationRotationSizeSizeAnchor pointAnchor pointHairlineHairlineLeftLeft……Stroke widthStroke widthStroke colorStroke colorStroke styleStroke styleFill colorFill colorOffsetOffsetxxyyHCenterHCenterRightRightTopTopVCenterVCenterBottomBottomJoin styleJoin style ° °WidgetSvgMarkerFormFormAnchor pointAnchor pointLeftLeftHCenterHCenterRightRightTopTopVCenterVCenterBottomBottomSizeSize……RotationRotationOffsetOffsetStroke widthStroke widthWidthWidthHeightHeightLock aspect ratioLock aspect ratioxxyyStroke colorStroke colorNo strokeNo strokeFill colorFill colorSVG GroupsSVG GroupsSVG ImageSVG Image ° °WidgetSvgSelectorFormFormSVG ImagesSVG ImagesSVG GroupsSVG GroupsWidgetTransformFormFormShear X,YShear X,YRotationRotation ° °Reflect horizontalReflect horizontalReflect verticalReflect verticalTranslate X,YTranslate X,Y%%Scale X,YScale X,YDraw modeDraw modeWidgetVectorFieldBaseFormFormY attributeY attributeScaleScaleX attributeX attributeVector field typeVector field typeHeight onlyHeight onlyPolarPolarCartesianCartesianAngle unitsAngle unitsDegreesDegreesRadiansRadiansAngle orientationAngle orientationCounterclockwise from eastCounterclockwise from eastClockwise from northClockwise from northDistance unitDistance unitWidgetWrapper (xmin, xmax, ymin, ymax) (xmin, xmax, ymin, ymax) (x, y) (x, y) [optional] [optional]Select FileSelect FileXMLDialogXML Request / ResponseXML Request / ResponseRequestRequestResponseResponseZonalStatisticsRaster analysisRaster analysisCountCountSumSumMeanMeanMedianMedianStd. dev.Std. dev.MinMinMaxMaxRangeRangeMinorityMinorityMajority (mode)Majority (mode)VarietyVarietyVarianceVarianceAllAllRaster layerRaster layerRaster bandRaster bandVector layer containing zonesVector layer containing zonesOutput column prefixOutput column prefixStatistics to calculateStatistics to calculateZonal statisticsZonal statisticsalgYou need to set either inline data positions or an input data positions file!You need to set either inline data positions or an input data positions file!You need to set either sampling data positions or an output sampling data positions file!You need to set either sampling data positions or an output sampling data positions file!You need to set input and output data positions parameters!You need to set input and output data positions parameters!You need to set at least source/sink_where or source/sink_cats parameters for each set!You need to set at least source/sink_where or source/sink_cats parameters for each set!You need to set either inline configuration or a configuration file!You need to set either inline configuration or a configuration file!Your configuration needs to be a "moving window" configuration!Your configuration needs to be a "moving window" configuration!Your configuration needs to be a non "moving window" configuration!Your configuration needs to be a non "moving window" configuration!You need to set either start coordinates OR a start points vector layer!You need to set either start coordinates OR a start points vector layer!-c, -a, -n parameters are mutually exclusive!-c, -a, -n parameters are mutually exclusive!The step must be greater than zero!The step must be greater than zero!GRASS GIS 7 v.net requires a lines layer!GRASS GIS 7 v.net requires a lines layer!You can't use original Hargreaves flag and precipitation parameter together!You can't use original Hargreaves flag and precipitation parameter together!If you don't use original Hargreaves flag, you must set the precipitation raster parameter!If you don't use original Hargreaves flag, you must set the precipitation raster parameter!The number of columns and the number of upload parameters should be equal!The number of columns and the number of upload parameters should be equal!You need to set at least 'setnull' or 'null' parameters for this algorithm!You need to set at least 'setnull' or 'null' parameters for this algorithm!You need to set either inline expression or a rules file!You need to set either inline expression or a rules file!You need to set either a rules file or write directly the rules!You need to set either a rules file or write directly the rules!The start position must be inferior to the end position!The start position must be inferior to the end position!You need to set either radius or x_radius and y_radius!You need to set either radius or x_radius and y_radius!You need to set x_radius and y_radius!You need to set x_radius and y_radius!You need to set either rules or a raster from which to copy categories!You need to set either rules or a raster from which to copy categories!You need to set either inline rules or a rules file!You need to set either inline rules or a rules file!You need to set either an input control point file or inline control points!You need to set either an input control point file or inline control points!You need to set either a fixed height value or the height column!You need to set either a fixed height value or the height column!You need to set either an input ASCII file or inline data!You need to set either an input ASCII file or inline data!You need to set at least setX_where or setX_cats parameters for each set!You need to set at least setX_where or setX_cats parameters for each set!algorithm_idUnique ID for algorithm.Unique ID for algorithm.appinfoQGIS DesktopQGIS Desktop<p>QGIS is a user friendly Open Source Geographic Information System (GIS) licensed under the GNU General Public License. QGIS is an official project of the Open Source Geospatial Foundation (OSGeo). It runs on Linux, Unix, Mac OSX, Windows and Android and supports numerous vector, raster, and database formats and functionalities.</p><p>QGIS is a user friendly Open Source Geographic Information System (GIS) licensed under the GNU General Public License. QGIS is an official project of the Open Source Geospatial Foundation (OSGeo). It runs on Linux, Unix, Mac OSX, Windows and Android and supports numerous vector, raster, and database formats and functionalities.</p>Geographic Information SystemGeographic Information SystemA Free and Open Source Geographic Information SystemA Free and Open Source Geographic Information SystemaspectInput layerInput layerBand numberBand numberReturn trigonometric angle instead of azimuthReturn trigonometric angle instead of azimuthReturn 0 for flat instead of -9999Return 0 for flat instead of -9999Compute edgesCompute edgesUse Zevenbergen&Thorne formula instead of the Horn's oneUse Zevenbergen&Thorne formula instead of the Horn's oneAdditional creation optionsAdditional creation optionsRaster analysisRaster analysisAspectAspectbuildvrtBuild virtual rasterBuild virtual rasterRaster miscellaneousRaster miscellaneouscheckDockValidate AllValidate AllValidate ExtentValidate ExtentTopology not checked yetTopology not checked yetConfigureConfigureShow topology errorsShow topology errorsTopology Checker PanelTopology Checker PanelShow errorsShow errorsSelect automatic fixSelect automatic fixFix!Fix!No errors were foundNo errors were foundInvalid first layerInvalid first layerTopology pluginTopology pluginInvalid first geometryInvalid first geometryTopology testTopology testFeature not found in the layer.
The layer has probably changed.
Run topology check again.Feature not found in the layer.
The layer has probably changed.
Run topology check again.Invalid second layerInvalid second layerInvalid second geometryInvalid second geometryInvalid conflictInvalid conflict%1 errors were found%1 errors were foundTopology fix errorTopology fix errorFixing failed!Fixing failed!Layer %1 not found in registry.Layer %1 not found in registry.AbortAbortcluster_colorColor of symbols within a cluster, or NULL if symbols have mixed colors.Color of symbols within a cluster, or NULL if symbols have mixed colors.cluster_sizeNumber of symbols contained within a cluster.Number of symbols contained within a cluster.contourContourContourInput layerInput layerBand numberBand numberInterval between contour linesInterval between contour linesAttribute name (if not set, no elevation attribute is attached)Attribute name (if not set, no elevation attribute is attached)Produce 3D vectorProduce 3D vectorTreat all raster values as validTreat all raster values as validInput pixel value to treat as "nodata"Input pixel value to treat as "nodata"Offset from zero relative to which to interpret intervalsOffset from zero relative to which to interpret intervalsAdditional creation optionsAdditional creation optionsRaster extractionRaster extractionContoursContourscurrent_featureRepresents the feature currently being edited in the form or the table row. Can be used in a form/row context to filter the related features.Represents the feature currently being edited in the form or the table row. Can be used in a form/row context to filter the related features.current_geometryRepresents the geometry of the feature currently being edited in the form or the table row. Can be used in a form/row context to filter the related features.Represents the geometry of the feature currently being edited in the form or the table row. Can be used in a form/row context to filter the related features.dataobjectCould not load layer: {0}
Check the processing framework log to look for errors.Could not load layer: {0}
Check the processing framework log to look for errors.db_managerPostGISPostGISSpatiaLiteSpatiaLiteGeoPackageGeoPackageVirtual LayersVirtual LayersProject layersProject layersOracle SpatialOracle SpatialeViseVis Database ConnectioneVis Database ConnectioneVis Event Id TooleVis Event Id TooleVis Event BrowsereVis Event BrowserCreate layer from a database queryCreate layer from a database queryOpen an Event Browser and display the selected featureOpen an Event Browser and display the selected featureOpen an Event Browser to explore the current layer's featuresOpen an Event Browser to explore the current layer's featureseVisDatabaseConnectionGuiUndefinedUndefinedNo predefined queries loadedNo predefined queries loadedOpen FileOpen FileNew Database connection requested…New Database connection requested…Error: You must select a database typeError: You must select a database typeError: No host name enteredError: No host name enteredError: No database name enteredError: No database name enteredConnection to [%1.%2] establishedConnection to [%1.%2] establishedconnectedconnectedTablesTablesConnection to [%1.%2] failed: %3Connection to [%1.%2] failed: %3Error: Parse error at line %1, column %2: %3Error: Parse error at line %1, column %2: %3Error: Unable to open file [%1]Error: Unable to open file [%1]Error: Query failed: %1Error: Query failed: %1Error: Could not create temporary file, process haltedError: Could not create temporary file, process haltedError: A database connection is not currently establishedError: A database connection is not currently establishedeVisDatabaseConnectionGuiBaseDatabase ConnectionDatabase ConnectionPredefined QueriesPredefined QueriesLoad predefined queriesLoad predefined queriesLoads an XML file with predefined queries. Use the Open File window to locate the XML file that contains one or more predefined queries using the format described in the user guide.Loads an XML file with predefined queries. Use the Open File window to locate the XML file that contains one or more predefined queries using the format described in the user guide.The description of the selected query.The description of the selected query.Select the predefined query you want to use from the drop-down list containing queries identified from the file loaded using the Open File icon above. To run the query you need to click on the SQL Query tab. The query will be automatically entered in the query window.Select the predefined query you want to use from the drop-down list containing queries identified from the file loaded using the Open File icon above. To run the query you need to click on the SQL Query tab. The query will be automatically entered in the query window.not connectednot connected<html><head><meta name="qrichtext" content="1" /><style type="text/css">
p, li { white-space: pre-wrap; }
</style></head><body style=" font-family:'Sans Serif'; font-size:9pt; font-weight:400; font-style:normal; text-decoration:none;">
<p style=" margin-top:0px; margin-bottom:0px; margin-left:0px; margin-right:0px; -qt-block-indent:0; text-indent:0px;"><span style=" font-style:italic;">Connection Status: </span></p></body></html><html><head><meta name="qrichtext" content="1" /><style type="text/css">
p, li { white-space: pre-wrap; }
</style></head><body style=" font-family:'Sans Serif'; font-size:9pt; font-weight:400; font-style:normal; text-decoration:none;">
<p style=" margin-top:0px; margin-bottom:0px; margin-left:0px; margin-right:0px; -qt-block-indent:0; text-indent:0px;"><span style=" font-style:italic;">Connection Status: </span></p></body></html>Database HostDatabase HostEnter the database host. If the database resides on your desktop you should enter ¨localhost¨. If you selected ¨MSAccess¨ as the database type this option will not be available. Enter the database host. If the database resides on your desktop you should enter ¨localhost¨. If you selected ¨MSAccess¨ as the database type this option will not be available. Password to access the database.Password to access the database.Enter the name of the database.Enter the name of the database.UsernameUsernameEnter the port through which the database must be accessed if a MYSQL database is used.Enter the port through which the database must be accessed if a MYSQL database is used.Connect to the database using the parameters selected above. If the connection was successful a message will be displayed in the Output Console below saying the connection was established. Connect to the database using the parameters selected above. If the connection was successful a message will be displayed in the Output Console below saying the connection was established. ConnectConnectUser name to access the database.User name to access the database.Select the type of database from the list of supported databases in the drop-down menu.Select the type of database from the list of supported databases in the drop-down menu.Database NameDatabase NamePasswordPasswordDatabase TypeDatabase TypePortPortSQL QuerySQL QueryRun the query entered above. The status of the query will be displayed in the Output Console below.Run the query entered above. The status of the query will be displayed in the Output Console below.Run QueryRun QueryEnter the query you want to run in this window.Enter the query you want to run in this window.A window for status messages to be displayed.A window for status messages to be displayed.Output ConsoleOutput ConsoleeVisDatabaseLayerFieldSelectionGuiBaseDatabase File SelectionDatabase File SelectionThe name of the field that contains the Y coordinate of the points.The name of the field that contains the Y coordinate of the points.The name of the field that contains the X coordinate of the points.The name of the field that contains the X coordinate of the points.Enter the name for the new layer that will be created and displayed in QGIS.Enter the name for the new layer that will be created and displayed in QGIS.Y CoordinateY CoordinateX CoordinateX CoordinateName of New LayerName of New LayereVisGenericEventBrowserGuiGeneric Event BrowserGeneric Event BrowserFieldFieldValueValueThis tool only supports vector data.This tool only supports vector data.No active layers found.No active layers found.Unable to connect to either the map canvas or application interface.Unable to connect to either the map canvas or application interface.An invalid feature was received during initialization.An invalid feature was received during initialization.Event Browser - Displaying Records 01 of %1Event Browser - Displaying Records 01 of %1Event Browser - Displaying Records %1 of %2Event Browser - Displaying Records %1 of %2Attribute ContentsAttribute ContentsSelect ApplicationSelect ApplicationAll ( * )All ( * )eVisGenericEventBrowserGuiBaseDisplayDisplayUse the Previous button to display the previous photo when more than one photo is available for display.Use the Previous button to display the previous photo when more than one photo is available for display.Use the Next button to display the next photo when more than one photo is available for display.Use the Next button to display the next photo when more than one photo is available for display.All of the attribute information for the point associated with the photo being viewed is displayed here. If the file type being referenced in the displayed record is not an image but is of a file type defined in the “Configure External Applications” tab then when you double-click on the value of the field containing the path to the file the application to open the file will be launched to view or hear the contents of the file. If the file extension is recognized the attribute data will be displayed in green.All of the attribute information for the point associated with the photo being viewed is displayed here. If the file type being referenced in the displayed record is not an image but is of a file type defined in the “Configure External Applications” tab then when you double-click on the value of the field containing the path to the file the application to open the file will be launched to view or hear the contents of the file. If the file extension is recognized the attribute data will be displayed in green.11Image display areaImage display areaDisplay area for the image.Display area for the image.OptionsOptionsFile pathFile pathAttribute containing path to fileAttribute containing path to filePath is relativePath is relativeIf checked, the relative path values will be saved for the next session.If checked, the relative path values will be saved for the next session.Remember thisRemember thisReset to defaultReset to defaultResets the values on this line to the default setting.Resets the values on this line to the default setting.ResetReset<html><head/><body><p>Use the drop-down list to select the field containing a directory path to the image. This can be an absolute or relative path.</p></body></html><html><head/><body><p>Use the drop-down list to select the field containing a directory path to the image. This can be an absolute or relative path.</p></body></html><html><head/><body><p>If checked the path to the image will be defined appending the attribute in the field selected from the “Attribute Containing Path to Image” drop-down list to the “Base Path” defined below.</p></body></html><html><head/><body><p>If checked the path to the image will be defined appending the attribute in the field selected from the “Attribute Containing Path to Image” drop-down list to the “Base Path” defined below.</p></body></html>Compass bearingCompass bearing<html><head/><body><p>Use the drop-down list to select the field containing the compass bearing for the image.</p><p>This bearing usually references the direction the camera was pointing when the image was acquired. </p></body></html><html><head/><body><p>Use the drop-down list to select the field containing the compass bearing for the image.</p><p>This bearing usually references the direction the camera was pointing when the image was acquired. </p></body></html>Attribute containing compass bearingAttribute containing compass bearingDisplay compass bearingDisplay compass bearingIf checked, the Display Compass Bearing values will be saved for the next session.If checked, the Display Compass Bearing values will be saved for the next session.Compass offsetCompass offsetDefine the compass offset manually.Define the compass offset manually.ManualManualDefine the compass offset using a field from the vector layer attribute table.Define the compass offset using a field from the vector layer attribute table. From Attribute From AttributeIf checked, the compass offset values will be saved for the next session.If checked, the compass offset values will be saved for the next session.Resets the compass offset values to the default settings.Resets the compass offset values to the default settings.Relative pathsRelative pathsThe base path or url from which images and documents can be “relative”The base path or url from which images and documents can be “relative”Base PathBase PathThe Base Path onto which the relative path defined above will be appended.The Base Path onto which the relative path defined above will be appended.If checked, the Base Path will be saved for the next session.If checked, the Base Path will be saved for the next session.Enters the default “Base Path” which is the path to the directory of the vector layer containing the image information.Enters the default “Base Path” which is the path to the directory of the vector layer containing the image information.Replace entire path/url stored in image path attribute with user defined
Base Path (i.e. keep only filename from attribute)Replace entire path/url stored in image path attribute with user defined
Base Path (i.e. keep only filename from attribute)Apply Path to Image rules when loading docs in external applicationsApply Path to Image rules when loading docs in external applications<html><head/><body><p>If checked an arrow pointing in the direction defined by the attribute in the field selected from the drop-down list</p><p>to the right will be displayed in the QGIS window on top of the point for this image.</p></body></html><html><head/><body><p>If checked an arrow pointing in the direction defined by the attribute in the field selected from the drop-down list</p><p>to the right will be displayed in the QGIS window on top of the point for this image.</p></body></html><html><head/><body><p>A value to be added to the compass bearing.</p><p>This allows you to compensate for declination (adjust bearings collected using magnetic bearings to true north bearings). East declinations should be entered using positive values and west declinations should use negative values. </p></body></html><html><head/><body><p>A value to be added to the compass bearing.</p><p>This allows you to compensate for declination (adjust bearings collected using magnetic bearings to true north bearings). East declinations should be entered using positive values and west declinations should use negative values. </p></body></html><html><head/><body><p>Use the drop-down list to select the field containing the compass bearing offset.</p><p>This allows you to compensate for declination (adjust bearings collected using magnetic bearings to true north bearings). East declinations should be entered using positive values and west declinations should use negative values. </p></body></html><html><head/><body><p>Use the drop-down list to select the field containing the compass bearing offset.</p><p>This allows you to compensate for declination (adjust bearings collected using magnetic bearings to true north bearings). East declinations should be entered using positive values and west declinations should use negative values. </p></body></html><html><head/><body><p>If checked, the Base Path will append only the file name instead of the entire relative path (defined above) to create the full directory path to the file. </p></body></html><html><head/><body><p>If checked, the Base Path will append only the file name instead of the entire relative path (defined above) to create the full directory path to the file. </p></body></html>If checked, the current checkbox setting will be saved for the next session.If checked, the current checkbox setting will be saved for the next session.Clears the checkbox on this line.Clears the checkbox on this line.<html><head/><body><p>If checked, the same path rules that are defined for images will be used for non-image documents such as movies, text documents, and sound files.</p><p>If not checked the path rules will only apply to images and other documents will ignore the Base Path parameter.</p></body></html><html><head/><body><p>If checked, the same path rules that are defined for images will be used for non-image documents such as movies, text documents, and sound files.</p><p>If not checked the path rules will only apply to images and other documents will ignore the Base Path parameter.</p></body></html><html><head/><body><p>Clicking on Save will save the settings without closing the Options pane.</p><p>Clicking on Restore Defaults will reset all of the fields to their default settings.</p><p>It has the same effect as clicking all of the “Reset to default” buttons. </p></body></html><html><head/><body><p>Clicking on Save will save the settings without closing the Options pane.</p><p>Clicking on Restore Defaults will reset all of the fields to their default settings.</p><p>It has the same effect as clicking all of the “Reset to default” buttons. </p></body></html>Configure External ApplicationsConfigure External ApplicationsFile extension and external application in which to load a document of that typeFile extension and external application in which to load a document of that typeA table containing file types that can be opened using eVis. Each file type needs a file extension and the path to an application that can open that type of file. This provides the capability of opening a broad range of files such as movies, sound recording, and text documents instead of only images. A table containing file types that can be opened using eVis. Each file type needs a file extension and the path to an application that can open that type of file. This provides the capability of opening a broad range of files such as movies, sound recording, and text documents instead of only images. ExtensionExtensionApplicationApplicationAdd new file typeAdd new file typeAdd a new file type with a unique extension and the path for the application that can open the file.Add a new file type with a unique extension and the path for the application that can open the file.Delete current rowDelete current rowDelete the file type highlighted in the table and defined by a file extension and a path to an associated application.Delete the file type highlighted in the table and defined by a file extension and a path to an associated application.eVisImageDisplayWidgetZoom inZoom inZoom in to see more detail.Zoom in to see more detail.Zoom outZoom outZoom out to see more area.Zoom out to see more area.Zoom to full extentZoom to full extentZoom to display the entire image.Zoom to display the entire image.expression%1: Field not found %2%1: Field not found %2%1: function cannot be evaluated without a context.%1: function cannot be evaluated without a context.expressionsVectorVectorRasterRasterMeshMeshPluginPluginfillnodataInput layerInput layerValidity maskValidity maskBand numberBand numberMaximum distance (in pixels) to search out for values to interpolateMaximum distance (in pixels) to search out for values to interpolateNumber of smoothing iterations to run after the interpolationNumber of smoothing iterations to run after the interpolationDo not use the default validity mask for the input bandDo not use the default validity mask for the input bandFilledFilledFill nodataFill nodataRaster analysisRaster analysisform_modeWhat the form is used for, like AddFeatureMode, SingleEditMode, MultiEditMode, SearchMode, AggregateSearchMode or IdentifyMode as string.What the form is used for, like AddFeatureMode, SingleEditMode, MultiEditMode, SearchMode, AggregateSearchMode or IdentifyMode as string.fullextent_maxxMaximum x-value from full canvas extent (including all layers).Maximum x-value from full canvas extent (including all layers).fullextent_maxyMaximum y-value from full canvas extent (including all layers).Maximum y-value from full canvas extent (including all layers).fullextent_minxMinimum x-value from full canvas extent (including all layers).Minimum x-value from full canvas extent (including all layers).fullextent_minyMinimum y-value from full canvas extent (including all layers).Minimum y-value from full canvas extent (including all layers).gdal2tilesgdal2tilesgdal2tilesInput layerInput layerTile cutting profileTile cutting profileCopyright of the mapCopyright of the mapResampling methodResampling methodThe spatial reference system used for the source input dataThe spatial reference system used for the source input dataZoom levels to renderZoom levels to renderAvoid automatic generation of KML files for EPSG:4326Avoid automatic generation of KML files for EPSG:4326URL address where the generated tiles are going to be publishedURL address where the generated tiles are going to be publishedMercatorMercatorGeodeticGeodeticRasterRasterAverageAverageNearest neighbourNearest neighbourBilinearBilinearCubicCubicCubic splineCubic splineLanczos windowed sincLanczos windowed sincAntialiasAntialiasAllAllGoogleMapsGoogleMapsOpenLayersOpenLayersLeafletLeafletNoneNoneWeb viewer to generateWeb viewer to generateTitle of the mapTitle of the mapTransparency value to assign to the input dataTransparency value to assign to the input dataGoogle Maps API key (http://code.google.com/apis/maps/signup.html)Google Maps API key (http://code.google.com/apis/maps/signup.html)Bing Maps API key (https://www.bingmapsportal.com/)Bing Maps API key (https://www.bingmapsportal.com/)Generate only missing filesGenerate only missing filesGenerate KML for Google EarthGenerate KML for Google EarthOutput directoryOutput directoryRaster miscellaneousRaster miscellaneousgdal2xyzInput layerInput layerBand numberBand numberOutput comma-separated valuesOutput comma-separated valuesXYZ ASCII fileXYZ ASCII fileCSV files (*.csv)CSV files (*.csv)Raster conversionRaster conversiongdal2xyzgdal2xyzgdaladdoNearest neighbourNearest neighbourAverageAverageGaussianGaussianCubic convolution.Cubic convolution.B-Spline convolutionB-Spline convolutionLanczos windowed sincLanczos windowed sincAverage MPAverage MPAverage in mag/phase spaceAverage in mag/phase spaceModeModeInternal (if possible)Internal (if possible)External (GTiff .ovr)External (GTiff .ovr)External (ERDAS Imagine .aux)External (ERDAS Imagine .aux)Input layerInput layerOverview levelsOverview levelsRemove all existing overviewsRemove all existing overviewsResampling methodResampling methodOverviews formatOverviews formatRaster miscellaneousRaster miscellaneousPyramidizedPyramidizedBuild overviews (pyramids)Build overviews (pyramids)gdalcalcInput layer AInput layer AInput layer BInput layer BInput layer CInput layer CInput layer DInput layer DInput layer EInput layer EInput layer FInput layer FNumber of raster band for ANumber of raster band for ANumber of raster band for BNumber of raster band for BNumber of raster band for CNumber of raster band for CNumber of raster band for DNumber of raster band for DNumber of raster band for ENumber of raster band for ENumber of raster band for FNumber of raster band for FCalculation in gdalnumeric syntax using +-/* or any numpy array functions (i.e. logical_and())Calculation in gdalnumeric syntax using +-/* or any numpy array functions (i.e. logical_and())Set output nodata valueSet output nodata valueOutput raster typeOutput raster typeAdditional creation optionsAdditional creation optionsCalculatedCalculatedRaster calculatorRaster calculatorRaster miscellaneousRaster miscellaneousgdalinfoInput layerInput layerForce computation of the actual min/max values for each bandForce computation of the actual min/max values for each bandRead and display image statistics (force computation if necessary)Read and display image statistics (force computation if necessary)Suppress GCP infoSuppress GCP infoSuppress metadata infoSuppress metadata infoLayer informationLayer informationHTML files (*.html)HTML files (*.html)Raster informationRaster informationRaster miscellaneousRaster miscellaneousgdaltindexAutoAutoWell-known text (WKT)Well-known text (WKT)EPSGEPSGProj.4Proj.4Input filesInput filesField name to hold the file path to the indexed rastersField name to hold the file path to the indexed rastersStore absolute path to the indexed rastersStore absolute path to the indexed rastersSkip files with different projection referenceSkip files with different projection referenceTransform geometries to the given CRSTransform geometries to the given CRSThe name of the field to store the SRS of each tileThe name of the field to store the SRS of each tileThe format in which the CRS of each tile must be writtenThe format in which the CRS of each tile must be writtenTile indexTile indexRaster miscellaneousRaster miscellaneousAll layers must be raster layers!All layers must be raster layers!grasslabel(1-256)(1-256)(Optional) column to read labels(Optional) column to read labels3D-Viewer (NVIZ)3D-Viewer (NVIZ)3d Visualization3d VisualizationAdd a value to the current category valuesAdd a value to the current category valuesAdd elements to layer (ALL elements of the selected layer type!)Add elements to layer (ALL elements of the selected layer type!)Add missing centroids to closed boundariesAdd missing centroids to closed boundariesAdd one or more columns to attribute tableAdd one or more columns to attribute tableAggregates data of an existing space time raster dataset using the time intervals of a second space time datasetAggregates data of an existing space time raster dataset using the time intervals of a second space time datasetAggregates temporally the maps of a space time raster dataset by a user defined granularityAggregates temporally the maps of a space time raster dataset by a user defined granularityAggregationAggregationAllocate networkAllocate networkAssign constant value to columnAssign constant value to columnAssign new constant value to column only if the result of query is TRUEAssign new constant value to column only if the result of query is TRUEAssign new value as result of operation on columns to column in attribute tableAssign new value as result of operation on columns to column in attribute tableAssign new value to column as result of operation on columns only if the result of query is TRUEAssign new value to column as result of operation on columns only if the result of query is TRUEAttribute fieldAttribute fieldAttribute field (interpolated values)Attribute field (interpolated values)Attribute field to (over)writeAttribute field to (over)writeAttribute field to joinAttribute field to joinAuto-balancing of colors for LANDSAT-TM rasterAuto-balancing of colors for LANDSAT-TM rasterBicubic or bilinear spline interpolation with Tykhonov regularizationBicubic or bilinear spline interpolation with Tykhonov regularizationBilinear interpolation utility for raster mapsBilinear interpolation utility for raster mapsBlend color components for two rasters by given ratioBlend color components for two rasters by given ratioBlend red, green, raster layers to obtain one color rasterBlend red, green, raster layers to obtain one color rasterBreak (topologically clean) polygons (imported from non topological format, like ShapeFile). Boundaries are broken on each point shared between 2 and more polygons where angles of segments are differentBreak (topologically clean) polygons (imported from non topological format, like ShapeFile). Boundaries are broken on each point shared between 2 and more polygons where angles of segments are differentBreak lines at each intersection of vectorBreak lines at each intersection of vectorBrovey transform to merge multispectral and high-res panchromatic channelsBrovey transform to merge multispectral and high-res panchromatic channelsBufferBufferBuild polylines from linesBuild polylines from linesCalculate average of raster within areas with the same category in a user-defined base mapCalculate average of raster within areas with the same category in a user-defined base mapCalculate covariance/correlation matrix for user-defined rastersCalculate covariance/correlation matrix for user-defined rastersCalculate error matrix and kappa parameter for accuracy assessment of classification resultCalculate error matrix and kappa parameter for accuracy assessment of classification resultCalculate geometry statistics for vectorsCalculate geometry statistics for vectorsCalculate linear regression from two rasters: y = a + b*xCalculate linear regression from two rasters: y = a + b*xCalculate median of raster within areas with the same category in a user-defined base mapCalculate median of raster within areas with the same category in a user-defined base mapCalculate mode of raster within areas with the same category in a user-defined base mapCalculate mode of raster within areas with the same category in a user-defined base mapCalculate optimal index factor table for LANDSAT-TM rasterCalculate optimal index factor table for LANDSAT-TM rasterCalculate raster surface areaCalculate raster surface areaCalculate shadow maps from exact sun positionCalculate shadow maps from exact sun positionCalculate shadow maps from sun position determinated by date/timeCalculate shadow maps from sun position determinated by date/timeCalculate statistics for rasterCalculate statistics for rasterCalculate univariate statistics for numeric attributes in a data tableCalculate univariate statistics for numeric attributes in a data tableCalculate univariate statistics from raster based on vector objectsCalculate univariate statistics from raster based on vector objectsCalculate univariate statistics from the non-null cells of rasterCalculate univariate statistics from the non-null cells of rasterCalculate univariate statistics of vector map featuresCalculate univariate statistics of vector map featuresCalculate volume of data clumps, and create vector with centroids of clumpsCalculate volume of data clumps, and create vector with centroids of clumpsCalculates category or object oriented statisticsCalculates category or object oriented statisticsCalculates different types of vegetation indicesCalculates different types of vegetation indicesCalculates multiple linear regression from raster mapsCalculates multiple linear regression from raster mapsCalculates univariate statistics from the non-null cells for each registered 3D raster map of a space time 3D raster datasetCalculates univariate statistics from the non-null cells for each registered 3D raster map of a space time 3D raster datasetCalculates univariate statistics from the non-null cells for each registered raster map of a space time raster datasetCalculates univariate statistics from the non-null cells for each registered raster map of a space time raster datasetCalculates univariate statistics of attributes for each registered vector map of a space time vector datasetCalculates univariate statistics of attributes for each registered vector map of a space time vector datasetCategory or object oriented statisticsCategory or object oriented statisticsCatsCatsCats (select from the map or using their id)Cats (select from the map or using their id)Change category values and labelsChange category values and labelsChange fieldChange fieldChange layer numberChange layer numberChange resolutionChange resolutionChange the type of boundary dangle to lineChange the type of boundary dangle to lineChange the type of bridges connecting area and island or 2 islands from boundary to lineChange the type of bridges connecting area and island or 2 islands from boundary to lineChange the type of geometry elementsChange the type of geometry elementsChoose appropriate formatChoose appropriate formatColumns managementColumns managementCompares bit patterns with rasterCompares bit patterns with rasterCompress and decompress rasterCompress and decompress rasterCompress rasterCompress rasterCompute category quantiles using two passes.Compute category quantiles using two passes.Computes a coordinate transformation based on the control pointsComputes a coordinate transformation based on the control pointsComputes biomass growth, precursor of crop yield calculationComputes biomass growth, precursor of crop yield calculationComputes broad band albedo from surface reflectanceComputes broad band albedo from surface reflectanceComputes cyclic accumulations of a space time raster datasetComputes cyclic accumulations of a space time raster datasetComputes emissivity from NDVI, generic method for sparse landComputes emissivity from NDVI, generic method for sparse landConcentric circlesConcentric circlesConnect nodes by shortest route (traveling salesman)Connect nodes by shortest route (traveling salesman)Connect selected nodes by shortest tree (Steiner tree)Connect selected nodes by shortest tree (Steiner tree)Connect vector to databaseConnect vector to databaseConvert 2D vector to 3D by sampling rasterConvert 2D vector to 3D by sampling rasterConvert 2D vector to 3D vector by sampling of elevation raster. Default sampling by nearest neighbourConvert 2D vector to 3D vector by sampling of elevation raster. Default sampling by nearest neighbourConvert GRASS binary vector to GRASS ASCII vectorConvert GRASS binary vector to GRASS ASCII vectorConvert a raster to vector within GRASSConvert a raster to vector within GRASSConvert a vector to raster within GRASSConvert a vector to raster within GRASSConvert bearing and distance measurements to coordinates and vice versaConvert bearing and distance measurements to coordinates and vice versaConvert boundaries to linesConvert boundaries to linesConvert centroids to pointsConvert centroids to pointsConvert coordinatesConvert coordinatesConvert coordinates from one projection to another (cs2cs frontend)Convert coordinates from one projection to another (cs2cs frontend)Convert lines to boundariesConvert lines to boundariesConvert points to centroidsConvert points to centroidsConvert raster to vector areasConvert raster to vector areasConvert raster to vector linesConvert raster to vector linesConvert raster to vector pointsConvert raster to vector pointsConvert vector to raster using attribute valuesConvert vector to raster using attribute valuesConvert vector to raster using constantConvert vector to raster using constantConverts LAS LiDAR point clouds to a GRASS vector map with libLAS.Converts LAS LiDAR point clouds to a GRASS vector map with libLAS.Converts a space time raster dataset into a 3D raster mapConverts a space time raster dataset into a 3D raster mapConvex hullConvex hullCopy a tableCopy a tableCopy also attribute table (only the table of layer 1 is currently supported)Copy also attribute table (only the table of layer 1 is currently supported)Count of neighbouring pointsCount of neighbouring pointsCreate 3D volume map based on 2D elevation and value rastersCreate 3D volume map based on 2D elevation and value rastersCreate a MASK for limiting raster operationCreate a MASK for limiting raster operationCreate a MASK from raster map for limiting raster operationCreate a MASK from raster map for limiting raster operationCreate a MASK from vector map for limiting raster operationCreate a MASK from vector map for limiting raster operationCreate a map containing concentric ringsCreate a map containing concentric ringsCreate a raster planeCreate a raster planeCreate and add new table to vectorCreate and add new table to vectorCreate and/or modify raster support filesCreate and/or modify raster support filesCreate aspect raster from DEM (digital elevation model)Create aspect raster from DEM (digital elevation model)Create cross product of category values from multiple rastersCreate cross product of category values from multiple rastersCreate fractal surface of given fractal dimensionCreate fractal surface of given fractal dimensionCreate grid in current regionCreate grid in current regionCreate new GRASS location and transfer data into itCreate new GRASS location and transfer data into itCreate new GRASS location from metadata fileCreate new GRASS location from metadata fileCreate new GRASS location from raster dataCreate new GRASS location from raster dataCreate new GRASS location from vector dataCreate new GRASS location from vector dataCreate new layer with category values based upon user's reclassification of categories in existing rasterCreate new layer with category values based upon user's reclassification of categories in existing rasterCreate new location from .prj (WKT) fileCreate new location from .prj (WKT) fileCreate new raster by combining other rastersCreate new raster by combining other rastersCreate new vector by combining other vectorsCreate new vector by combining other vectorsCreate new vector with current region extentCreate new vector with current region extentCreate nodes on networkCreate nodes on networkCreate parallel line to input linesCreate parallel line to input linesCreate pointsCreate pointsCreate points along input linesCreate points along input linesCreate points/segments from input vector lines and positionsCreate points/segments from input vector lines and positionsCreate quantization file for floating-point rasterCreate quantization file for floating-point rasterAssigns a color table from an existing raster or raster3d map to each raster map of the space time raster datasetAssigns a color table from an existing raster or raster3d map to each raster map of the space time raster datasetAssigns a predefined color table to each raster map of the space time raster datasetAssigns a predefined color table to each raster map of the space time raster datasetAuto-balancing of colors for RGB imagesAuto-balancing of colors for RGB imagesColumn to store height valuesColumn to store height valuesColumn with height valuesColumn with height valuesCreate random 2D vector pointsCreate random 2D vector pointsCreate random 3D vector pointsCreate random 3D vector pointsCreate random cell values with spatial dependenceCreate random cell values with spatial dependenceCreate random pointsCreate random pointsCreate random rasterCreate random rasterCreate random vector point contained in rasterCreate random vector point contained in rasterCreate raster of distance to features in input layerCreate raster of distance to features in input layerCreate raster of gaussian deviates with user-defined mean and standard deviationCreate raster of gaussian deviates with user-defined mean and standard deviationCreate raster of uniform random deviates with user-defined rangeCreate raster of uniform random deviates with user-defined rangeCreate raster with contiguous areas grown by one cellCreate raster with contiguous areas grown by one cellCreate raster images with textural features from raster (first series of indices)Create raster images with textural features from raster (first series of indices)Create raster with textural features from raster (second series of indices)Create raster with textural features from raster (second series of indices)Create red, green and blue rasters combining hue, intensity, and saturation (his) values from rastersCreate red, green and blue rasters combining hue, intensity, and saturation (his) values from rastersCreate shaded mapCreate shaded mapCreate slope raster from DEM (digital elevation model)Create slope raster from DEM (digital elevation model)Create standard vectorsCreate standard vectorsCreate surface from rasterized contoursCreate surface from rasterized contoursCreate vector contour from raster at specified levelsCreate vector contour from raster at specified levelsCreate vector contour from raster at specified stepsCreate vector contour from raster at specified stepsCreate watershed basinCreate watershed basinCreate watershed subbasins rasterCreate watershed subbasins rasterCreates / modifies the color table for each raster map of the space time raster dataset according to user defined rulesCreates / modifies the color table for each raster map of the space time raster dataset according to user defined rulesCreates a latitude raster mapCreates a latitude raster mapCreates a longitude raster mapCreates a longitude raster mapCreates a raster map from LAS LiDAR points using univariate statistics.Creates a raster map from LAS LiDAR points using univariate statistics.Creates a space time datasetCreates a space time datasetCreates, edits, and lists groups of imagery data.Creates, edits, and lists groups of imagery data.Cut network by cost isolinesCut network by cost isolinesDXF vector layerDXF vector layerDatabaseDatabaseDatabase connectionDatabase connectionDatabase fileDatabase fileDatabase managementDatabase managementDelaunay triangulation (areas)Delaunay triangulation (areas)Delaunay triangulation (lines)Delaunay triangulation (lines)Delaunay triangulation, Voronoi diagram and convex hullDelaunay triangulation, Voronoi diagram and convex hullDelete category valuesDelete category valuesDetects accumulation patterns in temporally accumulated space time raster datasets created by t.rast.accumulateDetects accumulation patterns in temporally accumulated space time raster datasets created by t.rast.accumulateDevelop images and groupDevelop images and groupDevelop mapDevelop mapDirectory of rasters to be linkedDirectory of rasters to be linkedDisconnect vector from databaseDisconnect vector from databaseDisplay general DB connectionDisplay general DB connectionDisplay list of category values found in rasterDisplay list of category values found in rasterDisplay projection information from PROJ.4 projection description fileDisplay projection information from PROJ.4 projection description fileDisplay projection information from PROJ.4 projection description file and create a new location based on itDisplay projection information from PROJ.4 projection description file and create a new location based on itDisplay projection information from a georeferenced file (raster, vector or image) and create a new location based on itDisplay projection information from a georeferenced file (raster, vector or image) and create a new location based on itDisplay projection information from georeferenced ASCII file containing WKT projection descriptionDisplay projection information from georeferenced ASCII file containing WKT projection descriptionDisplay projection information from georeferenced ASCII file containing WKT projection description and create a new location based on itDisplay projection information from georeferenced ASCII file containing WKT projection description and create a new location based on itDisplay projection information from georeferenced file (raster, vector or image)Display projection information from georeferenced file (raster, vector or image)Display projection information of the current locationDisplay projection information of the current locationDisplay raster category values and labelsDisplay raster category values and labelsDisplay results of SQL selection from databaseDisplay results of SQL selection from databaseDisplay the HTML manual pages of GRASSDisplay the HTML manual pages of GRASSDisplay vector attributesDisplay vector attributesDisplay vector map attributes with SQLDisplay vector map attributes with SQLDissolves boundaries between adjacent areas sharing a common category number or attributeDissolves boundaries between adjacent areas sharing a common category number or attributeDownload and import data from WMS serverDownload and import data from WMS serverDrapes a color raster over an shaded relief or aspect mapDrapes a color raster over an shaded relief or aspect mapDrop column from attribute tableDrop column from attribute tableE00 vector layerE00 vector layerElevation raster for height extraction (optional)Elevation raster for height extraction (optional)Execute any SQL statementExecute any SQL statementExportExportExport 3 GRASS rasters (R,G,B) to PPM image at the resolution of the current regionExport 3 GRASS rasters (R,G,B) to PPM image at the resolution of the current regionExport from GRASSExport from GRASSExport raster as non-georeferenced PNG image formatExport raster as non-georeferenced PNG image formatExport raster from GRASSExport raster from GRASSExport raster series to MPEG movieExport raster series to MPEG movieExport raster to 8/24bit TIFF image at the resolution of the current regionExport raster to 8/24bit TIFF image at the resolution of the current regionExport raster to ASCII text fileExport raster to ASCII text fileExport raster to ESRI ARCGRIDExport raster to ESRI ARCGRIDExport raster to GRIDATB.FOR map file (TOPMODEL)Export raster to GRIDATB.FOR map file (TOPMODEL)Export raster to Geo TIFFExport raster to Geo TIFFExport raster to POVRAY height-field fileExport raster to POVRAY height-field fileExport raster to PPM image at the resolution of the current regionExport raster to PPM image at the resolution of the current regionExport raster to VTK-ASCIIExport raster to VTK-ASCIIExport raster to Virtual Reality Modeling Language (VRML)Export raster to Virtual Reality Modeling Language (VRML)Export raster to binary MAT-FileExport raster to binary MAT-FileExport raster to binary arrayExport raster to binary arrayExport raster to text file as x,y,z values based on cell centersExport raster to text file as x,y,z values based on cell centersExport raster to various formats (GDAL library)Export raster to various formats (GDAL library)Export vector from GRASSExport vector from GRASSExport vector table from GRASS to database formatExport vector table from GRASS to database formatExport vector to DXFExport vector to DXFExport vector to GMLExport vector to GMLExport vector to MapinfoExport vector to MapinfoExport vector to POV-RayExport vector to POV-RayExport vector to PostGIS (PostgreSQL) database tableExport vector to PostGIS (PostgreSQL) database tableExport vector to SVGExport vector to SVGExport vector to ShapefileExport vector to ShapefileExport vector to VTK-ASCIIExport vector to VTK-ASCIIExport vector to various formats (OGR library)Export vector to various formats (OGR library)Exports a raster map as GRASS GIS specific archive fileExports a raster map as GRASS GIS specific archive fileExports a space time vector dataset as GRASS GIS specific archive fileExports a space time vector dataset as GRASS GIS specific archive fileExports a vector map as GRASS GIS specific archive fileExports a vector map as GRASS GIS specific archive fileExports attribute tables into various formatExports attribute tables into various formatExports space time raster datasetExports space time raster datasetExports space time raster dataset as VTK time seriesExports space time raster dataset as VTK time seriesExtract features from vectorExtract features from vectorExtract selected featuresExtract selected featuresExtractionExtractionExtracts a subset of a space time 3D raster datasetExtracts a subset of a space time 3D raster datasetExtracts a subset of a space time raster datasetExtracts a subset of a space time raster datasetExtracts a subset of a space time vector datasetExtracts a subset of a space time vector datasetExtracts quality control parameters from MODIS QC layersExtracts quality control parameters from MODIS QC layersExtracts terrain parameters from DEMExtracts terrain parameters from DEMExtrudes flat vector object to 3D with fixed heightExtrudes flat vector object to 3D with fixed heightExtrudes flat vector object to 3D with height based on attributeExtrudes flat vector object to 3D with height based on attributeFast fourier transform for image processingFast fourier transform for image processingFeature type (for polygons, choose Boundary)Feature type (for polygons, choose Boundary)File managementFile managementFill lake from seed at given levelFill lake from seed at given levelFill lake from seed point at given levelFill lake from seed point at given levelFill no-data areas in raster using v.surf.rst splines interpolationFill no-data areas in raster using v.surf.rst splines interpolationFilter and create depressionless elevation map and flow direction map from elevation rasterFilter and create depressionless elevation map and flow direction map from elevation rasterFilter imageFilter imageFind nearest element in vector 'to' for elements in vector 'from'. Various information about this relation may be uploaded to attribute table of input vector 'from'Find nearest element in vector 'to' for elements in vector 'from'. Various information about this relation may be uploaded to attribute table of input vector 'from'Find shortest path on vector networkFind shortest path on vector networkGRASS MODULESGRASS MODULESGRASS shellGRASS shellGaussian kernel densityGaussian kernel densityGeneralizationGeneralizationGenerate raster of cumulative cost of moving between locations based on cost input raster and starting point(s) coordinatesGenerate raster of cumulative cost of moving between locations based on cost input raster and starting point(s) coordinatesGenerate raster of cumulative cost of moving between locations based on cost input raster and starting point(s) rasterGenerate raster of cumulative cost of moving between locations based on cost input raster and starting point(s) rasterGenerate raster of cumulative cost of moving between locations based on cost input raster and starting point(s) vectorGenerate raster of cumulative cost of moving between locations based on cost input raster and starting point(s) vectorGenerate raster of cumulative cost of moving between locations, based on elevation and friction input rasters and starting point(s) coordinatesGenerate raster of cumulative cost of moving between locations, based on elevation and friction input rasters and starting point(s) coordinatesGenerate raster of cumulative cost of moving between locations, based on elevation and friction input rasters and starting point(s) vectorGenerate raster of cumulative cost of moving between locations, based on elevation and friction input rasters and starting point(s) vectorGenerate surfaceGenerate surfaceGenerate vector contour linesGenerate vector contour linesGenerates area statistics for rastersGenerates area statistics for rastersGeoreferencing, rectification, and import Terra-ASTER imagery and DEM using gdalwarpGeoreferencing, rectification, and import Terra-ASTER imagery and DEM using gdalwarpGraphical raster map calculatorGraphical raster map calculatorHelpHelpHue Intensity Saturation (HIS) to Red Green Blue (RGB) raster color transform functionHue Intensity Saturation (HIS) to Red Green Blue (RGB) raster color transform functionHydrologic modellingHydrologic modellingIdentifies segments (objects) from imagery data.Identifies segments (objects) from imagery data.Image fusion algorithms to sharpen multispectral with high-res panchromatic channelsImage fusion algorithms to sharpen multispectral with high-res panchromatic channelsImageryImageryImportImportImport ASCII rasterImport ASCII rasterImport DXF vectorImport DXF vectorImport ESRI ARC/INFO ASCII GRIDImport ESRI ARC/INFO ASCII GRIDImport ESRI E00 vectorImport ESRI E00 vectorImport GDAL supported rasterImport GDAL supported rasterImport GDAL supported raster and create a fitted locationImport GDAL supported raster and create a fitted locationImport GRIDATB.FOR (TOPMODEL)Import GRIDATB.FOR (TOPMODEL)Import MapGen or MatLab vectorImport MapGen or MatLab vectorImport OGR vectorImport OGR vectorImport OGR vector and create a fitted locationImport OGR vector and create a fitted locationImport OGR vectors in a given data source combining them in a GRASS vectorImport OGR vectors in a given data source combining them in a GRASS vectorImport SPOT VGT NDVIImport SPOT VGT NDVIImport SRTM HGTImport SRTM HGTImport US-NGA GEOnet Names Server (GNS) country fileImport US-NGA GEOnet Names Server (GNS) country fileImport all OGR/PostGIS vectors in a given data source and create a fitted locationImport all OGR/PostGIS vectors in a given data source and create a fitted locationImport attribute tables in various formatsImport attribute tables in various formatsImport binary MAT-File(v4)Import binary MAT-File(v4)Import binary rasterImport binary rasterImport from database into GRASSImport from database into GRASSImport geonames.org country filesImport geonames.org country filesImport into GRASSImport into GRASSImport loaded rasterImport loaded rasterImport loaded raster and create a fitted locationImport loaded raster and create a fitted locationImport loaded vectorImport loaded vectorImport loaded vector and create a fitted locationImport loaded vector and create a fitted locationImport only some layers of a DXF vectorImport only some layers of a DXF vectorImport raster from ASCII polygon/lineImport raster from ASCII polygon/lineImport raster from coordinates using univariate statisticsImport raster from coordinates using univariate statisticsImport raster into GRASSImport raster into GRASSImport raster into GRASS from QGIS viewImport raster into GRASS from QGIS viewImport raster into GRASS from external data sources in GRASSImport raster into GRASS from external data sources in GRASSImport text fileImport text fileImport vector from gps using gpsbabelImport vector from gps using gpsbabelImport vector from gps using gpstransImport vector from gps using gpstransImport vector into GRASSImport vector into GRASSImport vector points from database table containing coordinatesImport vector points from database table containing coordinatesImports a raster map as GRASS GIS specific archive file (packed with r.pack).Imports a raster map as GRASS GIS specific archive file (packed with r.pack).Imports a space time vector dataset from a GRASS GIS specific archive fileImports a space time vector dataset from a GRASS GIS specific archive fileImports a vector map as GRASS GIS specific archive file (packed with v.pack).Imports a vector map as GRASS GIS specific archive file (packed with v.pack).Imports space time raster datasetImports space time raster datasetInput nodesInput nodesInput tableInput tableInterpolate surfaceInterpolate surfaceInverse distance squared weighting raster interpolationInverse distance squared weighting raster interpolationInverse distance squared weighting raster interpolation based on vector pointsInverse distance squared weighting raster interpolation based on vector pointsInverse fast fourier transform for image processingInverse fast fourier transform for image processingJoin table to existing vector tableJoin table to existing vector tableLandsat 4 bands 1, 2, 3, 4, 5, 7Landsat 4 bands 1, 2, 3, 4, 5, 7Landsat 5 bands 1, 2, 3, 4, 5, 7Landsat 5 bands 1, 2, 3, 4, 5, 7Landsat 7 bands 1, 2, 3, 4, 5, 7Landsat 7 bands 1, 2, 3, 4, 5, 7Landsat 8 bands 2, 3, 4, 5, 6, 7Landsat 8 bands 2, 3, 4, 5, 6, 7Layers categories managementLayers categories managementLiDAR input files in LAS format (*.las or *.laz)LiDAR input files in LAS format (*.las or *.laz)Line-of-sight raster analysisLine-of-sight raster analysisLink GDAL supported raster as GRASS rasterLink GDAL supported raster as GRASS rasterLink GDAL supported raster loaded in QGIS as GRASS rasterLink GDAL supported raster loaded in QGIS as GRASS rasterLink all GDAL supported rasters in a directory as GRASS rastersLink all GDAL supported rasters in a directory as GRASS rastersLists information about space time datasets and mapsLists information about space time datasets and mapsLists registered maps of a space time raster datasetLists registered maps of a space time raster datasetLists registered maps of a space time raster3d datasetLists registered maps of a space time raster3d datasetLists space time datasets and maps registered in the temporal databaseLists space time datasets and maps registered in the temporal databaseLists temporal topology of a space time datasetLists temporal topology of a space time datasetLoaded layerLoaded layerLocate the closest points between objects in two raster mapsLocate the closest points between objects in two raster mapsMODIS bands 1, 2, 3, 4, 5, 6, 7MODIS bands 1, 2, 3, 4, 5, 6, 7Make each output cell function of the values assigned to the corresponding cells in the input rastersMake each output cell function of the values assigned to the corresponding cells in the input rastersManage datasetsManage datasetsManage featuresManage featuresManage image colorsManage image colorsManage map colorsManage map colorsManage maps in datasetsManage maps in datasetsManage raster cells valueManage raster cells valueManage training datasetManage training datasetMap algebraMap algebraMap type conversionMap type conversionMapGen or MatLab vector layerMapGen or MatLab vector layerMaskMaskMaximal tolerance value (higher value=more simplification)Maximal tolerance value (higher value=more simplification)Merges several space time datasets into a single space time dataset.Merges several space time datasets into a single space time dataset.Metadata supportMetadata supportMinimum size for each basin (number of cells)Minimum size for each basin (number of cells)Modifies the metadata of a space time dataset.Modifies the metadata of a space time dataset.Mosaic up to 4 imagesMosaic up to 4 imagesName for new raster file (specify file extension)Name for new raster file (specify file extension)Name for new vector file (specify file extension)Name for new vector file (specify file extension)Name for output vector map (optional)Name for output vector map (optional)Name for the output fileName for the output fileName for the output raster map (optional)Name for the output raster map (optional)Name of the output latitude raster mapName of the output latitude raster mapName of the output longitude raster mapName of the output longitude raster mapNeighborhood analysisNeighborhood analysisNetwork analysisNetwork analysisNetwork maintenanceNetwork maintenanceNumber of rows to be skippedNumber of rows to be skippedObserves specific locations in a space time raster dataset over a period of time using vector pointsObserves specific locations in a space time raster dataset over a period of time using vector pointsOthersOthersOutput GML fileOutput GML fileOutput ShapefileOutput ShapefileOutput file for regression coefficientsOutput file for regression coefficientsOutput layer name (used in GML file)Output layer name (used in GML file)Output raster values along user-defined transect line(s)Output raster values along user-defined transect line(s)Outputs basic information about a raster mapOutputs basic information about a raster mapOutputs basic information about a vector mapOutputs basic information about a vector mapOverlayOverlayOverlay mapsOverlay mapsPath to GRASS database of input location (optional)Path to GRASS database of input location (optional)Path to the OGR data sourcePath to the OGR data sourcePercentage of first layer (0-99)Percentage of first layer (0-99)Perform affine transformation (shift, scale and rotate, or GPCs) on vectorPerform affine transformation (shift, scale and rotate, or GPCs) on vectorPerforms a neighborhood analysis for each map in a space time raster datasetPerforms a neighborhood analysis for each map in a space time raster datasetPerforms different aggregation algorithms from r.series on all or a subset of raster maps in a space time raster datasetPerforms different aggregation algorithms from r.series on all or a subset of raster maps in a space time raster datasetPerforms spatio-temporal mapcalc expressions on temporally sampled maps of space time raster datasetsPerforms spatio-temporal mapcalc expressions on temporally sampled maps of space time raster datasetsPerforms spatio-temporal r3.mapcalc expressions on temporally sampled maps of space time 3D raster datasetsPerforms spatio-temporal r3.mapcalc expressions on temporally sampled maps of space time 3D raster datasetsPerforms transformation of 2D vector features to 3D with fixed heightPerforms transformation of 2D vector features to 3D with fixed heightPerforms transformation of 2D vector features to 3D with height based on attributePerforms transformation of 2D vector features to 3D with height based on attributePerforms transformation of 3D vector features to 2DPerforms transformation of 3D vector features to 2DPrint projection information from a georeferenced filePrint projection information from a georeferenced filePrint projection information from a georeferenced file and create a new location based on itPrint projection information from a georeferenced file and create a new location based on itPrint projection information of the current locationPrint projection information of the current locationPrints attributes of vector maps registered in a space time vector datasetPrints attributes of vector maps registered in a space time vector datasetPrints/sets general temporal GIS database connection for current mapsetPrints/sets general temporal GIS database connection for current mapsetProjection conversion of vectorProjection conversion of vectorProjection managementProjection managementPut geometry variables in databasePut geometry variables in databaseQuery raster mapsQuery raster mapsQuery rasters on their category values and labelsQuery rasters on their category values and labelsRandom location perturbations of vector pointsRandom location perturbations of vector pointsRandomly partition points into test/train setsRandomly partition points into test/train setsRasterRasterRaster bufferRaster bufferRaster file matrix filterRaster file matrix filterRaster neighbours analysisRaster neighbours analysisRaster supportRaster supportRe-project raster from a location to the current locationRe-project raster from a location to the current locationRebuild topology of a vector in mapsetRebuild topology of a vector in mapsetRebuild topology of all vectors in mapsetRebuild topology of all vectors in mapsetRecategorize contiguous cells to unique categoriesRecategorize contiguous cells to unique categoriesReclass category valuesReclass category valuesReclass category values using a column attribute (integer positive)Reclass category values using a column attribute (integer positive)Reclass category values using a rules fileReclass category values using a rules fileReclass raster using reclassification rulesReclass raster using reclassification rulesReclass raster with patches larger than user-defined area size (in hectares)Reclass raster with patches larger than user-defined area size (in hectares)Reclass raster with patches smaller than user-defined area size (in hectares)Reclass raster with patches smaller than user-defined area size (in hectares)Reclassify raster greater or less than user-defined area size (in hectares)Reclassify raster greater or less than user-defined area size (in hectares)Recode categorical raster using reclassification rulesRecode categorical raster using reclassification rulesRecode rasterRecode rasterReconnect vector to a new databaseReconnect vector to a new databaseRed Green Blue (RGB) to Hue Intensity Saturation (HIS) raster color transformation functionRed Green Blue (RGB) to Hue Intensity Saturation (HIS) raster color transformation functionRegion settingsRegion settingsRegister external data sources in GRASSRegister external data sources in GRASSRegisters raster, vector and raster3d maps in a space time datasetRegisters raster, vector and raster3d maps in a space time datasetRegularized spline with tension raster interpolation based on vector pointsRegularized spline with tension raster interpolation based on vector pointsReinterpolate and compute topographic analysis using regularized spline with tension and smoothingReinterpolate and compute topographic analysis using regularized spline with tension and smoothingRemove all lines or boundaries of zero lengthRemove all lines or boundaries of zero lengthRemove bridges connecting area and island or 2 islandsRemove bridges connecting area and island or 2 islandsRemove danglesRemove danglesRemove duplicate area centroidsRemove duplicate area centroidsRemove duplicate lines (pay attention to categories!)Remove duplicate lines (pay attention to categories!)Remove existing attribute table of vectorRemove existing attribute table of vectorRemove outliers from vector point dataRemove outliers from vector point dataRemove small angles between lines at nodesRemove small angles between lines at nodesRemove small areas, the longest boundary with adjacent area is removedRemove small areas, the longest boundary with adjacent area is removedRemove vertices in threshold from lines and boundaries, boundary is pruned only if topology is not damaged (new intersection, changed attachment of centroid), first and last segment of the boundary is never changedRemove vertices in threshold from lines and boundaries, boundary is pruned only if topology is not damaged (new intersection, changed attachment of centroid), first and last segment of the boundary is never changedSet raster color table from set tablesSet raster color table from set tablesRemoves space time datasets from temporal database.Removes space time datasets from temporal database.Rename column in attribute tableRename column in attribute tableRenames a space time datasetRenames a space time datasetReplaces gaps in a space time raster dataset with interpolated raster mapsReplaces gaps in a space time raster dataset with interpolated raster mapsReport and statisticsReport and statisticsReportsReportsReports and statisticsReports and statisticsReproject raster from another LocationReproject raster from another LocationResample raster using aggregationResample raster using aggregationResample raster using interpolationResample raster using interpolationResample raster. Set new resolution firstResample raster. Set new resolution firstRescale the range of category values in rasterRescale the range of category values in rasterSample a space time raster dataset at specific coordinates and write the output to file using different layoutsSample a space time raster dataset at specific coordinates and write the output to file using different layoutsSample raster at site locationsSample raster at site locationsSamples the input space time dataset(s) with a sample space time dataset and print the result to stdoutSamples the input space time dataset(s) with a sample space time dataset and print the result to stdoutSamplingSamplingSave the current region as a named regionSave the current region as a named regionSelect features by attributesSelect features by attributesSelect features overlapped by features in another mapSelect features overlapped by features in another mapSelect maps from space time datasets by topological relationshipsSelect maps from space time datasets by topological relationshipsSeparator (| , \t etc.)Separator (| , \t etc.)Set PostgreSQL DB connectionSet PostgreSQL DB connectionSet boundary definitions by edge (n-s-e-w)Set boundary definitions by edge (n-s-e-w)Set boundary definitions for rasterSet boundary definitions for rasterSet boundary definitions from rasterSet boundary definitions from rasterSet boundary definitions from vectorSet boundary definitions from vectorSet boundary definitions to current or default regionSet boundary definitions to current or default regionSet color rules based on stddev from a map's mean valueSet color rules based on stddev from a map's mean valueSet general DB connectionSet general DB connectionSet general DB connection with a schema (PostgreSQL only)Set general DB connection with a schema (PostgreSQL only)Set raster color tableSet raster color tableSet raster color table from existing rasterSet raster color table from existing rasterSet raster color table from user-defined rulesSet raster color table from user-defined rulesSet region to align to rasterSet region to align to rasterSet the region to match multiple rastersSet the region to match multiple rastersSet the region to match multiple vectorsSet the region to match multiple vectorsSet user/password for driver/databaseSet user/password for driver/databaseSets the boundary definitions for a raster mapSets the boundary definitions for a raster mapShifts temporally the maps of a space time datasetShifts temporally the maps of a space time datasetShow database connection for vectorShow database connection for vectorShrink current region until it meets non-NULL data from rasterShrink current region until it meets non-NULL data from rasterSimple map algebraSimple map algebraSimplify vectorSimplify vectorSnap lines to vertex in thresholdSnap lines to vertex in thresholdSnaps temporally the maps of a space time datasetSnaps temporally the maps of a space time datasetSolar and irradiation modelSolar and irradiation modelSpatial analysisSpatial analysisSpatial modelsSpatial modelsSplit lines to shorter segmentsSplit lines to shorter segmentsStatisticsStatisticsStores raster map values at spatial and temporal positions of vector points as vector attributesStores raster map values at spatial and temporal positions of vector points as vector attributesSum raster cell valuesSum raster cell valuesSurface managementSurface managementTables managementTables managementTabulate mutual occurrence (coincidence) of categories for two rastersTabulate mutual occurrence (coincidence) of categories for two rastersTake vector stream data, transform it to raster, and subtract depth from the output DEMTake vector stream data, transform it to raster, and subtract depth from the output DEMTasseled Cap (Kauth Thomas) transformation for LANDSAT-ETM 7 rasterTasseled Cap (Kauth Thomas) transformation for LANDSAT-ETM 7 rasterTasseled Cap (Kauth Thomas) transformation for LANDSAT-OLI 8 rasterTasseled Cap (Kauth Thomas) transformation for LANDSAT-OLI 8 rasterTasseled Cap (Kauth Thomas) transformation for LANDSAT-TM 4 rasterTasseled Cap (Kauth Thomas) transformation for LANDSAT-TM 4 rasterTasseled Cap (Kauth Thomas) transformation for LANDSAT-TM 5 rasterTasseled Cap (Kauth Thomas) transformation for LANDSAT-TM 5 rasterTasseled Cap (Kauth Thomas) transformation for MODIS rasterTasseled Cap (Kauth Thomas) transformation for MODIS rasterTemporalTemporalTemporal WHERE conditions without 'where' keywordTemporal WHERE conditions without 'where' keywordTerrain analysisTerrain analysisTests of normality on vector pointsTests of normality on vector pointsText fileText fileThin no-zero cells that denote line featuresThin no-zero cells that denote line featuresToolset for cleaning topology of vector mapToolset for cleaning topology of vector mapTopology managementTopology managementTrace a flow through an elevation modelTrace a flow through an elevation modelTransform cells with value in null cellsTransform cells with value in null cellsTransform featuresTransform featuresTransform imageTransform imageTransform null cells in value cellsTransform null cells in value cellsTransform or reproject vector from another LocationTransform or reproject vector from another LocationTransform value cells in null cellsTransform value cells in null cellsType in map names separated by a commaType in map names separated by a commaUnregisters raster, vector and raster3d maps from the temporal database or a specific space time datasetUnregisters raster, vector and raster3d maps from the temporal database or a specific space time datasetUpdate raster statisticsUpdate raster statisticsUpdate vector map metadataUpdate vector map metadataUpgrade all vectors from GRASS 6 to GRASS 7Upgrade all vectors from GRASS 6 to GRASS 7Upgrade from GRASS 6Upgrade from GRASS 6Upload raster values at positions of vector points to the tableUpload raster values at positions of vector points to the tableUpload vector values at positions of vector pointsUpload vector values at positions of vector pointsVectorVectorVector bufferVector bufferVector geometry analysisVector geometry analysisVector intersectionVector intersectionVector non-intersectionVector non-intersectionVector subtractionVector subtractionVector supervised classification tool which uses attributes as classification parametersVector supervised classification tool which uses attributes as classification parametersVector unionVector unionVector update by other mapsVector update by other mapsVegetation indicesVegetation indicesVisibility graph constructionVisibility graph constructionVoronoi diagram (area)Voronoi diagram (area)Voronoi diagram (lines)Voronoi diagram (lines)Watershed AnalysisWatershed AnalysisWhich column for the X coordinate? The first is 1Which column for the X coordinate? The first is 1Which column for the Y coordinate?Which column for the Y coordinate?Which column for the Z coordinate? If 0, z coordinate is not usedWhich column for the Z coordinate? If 0, z coordinate is not usedWork with vector pointsWork with vector pointsWrite only features link to a recordWrite only features link to a recordZero-crossing edge detection raster function for image processingZero-crossing edge detection raster function for image processinghillshadeInput layerInput layerBand numberBand numberScale (ratio of vertical units to horizontal)Scale (ratio of vertical units to horizontal)Compute edgesCompute edgesZ factor (vertical exaggeration)Z factor (vertical exaggeration)Azimuth of the lightAzimuth of the lightAltitude of the lightAltitude of the lightUse Zevenbergen&Thorne formula instead of the Horn's oneUse Zevenbergen&Thorne formula instead of the Horn's oneCombined shadingCombined shadingMultidirectional shadingMultidirectional shadingAdditional creation optionsAdditional creation optionsHillshadeHillshadeRaster analysisRaster analysismergeMergeMergeInput layersInput layersGrab pseudocolor table from first layerGrab pseudocolor table from first layerPlace each input file into a separate bandPlace each input file into a separate bandInput pixel value to treat as "nodata"Input pixel value to treat as "nodata"Assign specified "nodata" value to outputAssign specified "nodata" value to outputAdditional creation optionsAdditional creation optionsOutput data typeOutput data typeRaster miscellaneousRaster miscellaneousMergedMergednearblackInput layerInput layerHow far from black (white)How far from black (white)Search for nearly white pixels instead of nearly blackSearch for nearly white pixels instead of nearly blackAdditional creation optionsAdditional creation optionsNearblackNearblackNear blackNear blackRaster analysisRaster analysisnotification_messageContent of the notification message sent by the provider (available only for actions triggered by provider notifications).Content of the notification message sent by the provider (available only for actions triggered by provider notifications).ogr2ogrInput layerInput layerAdditional creation optionsAdditional creation optionsConvertedConvertedConvert formatConvert formatVector conversionVector conversionOutput file "{}" already exists.Output file "{}" already exists.ogrinfoInput layerInput layerSummary output onlySummary output onlySuppress metadata infoSuppress metadata infoLayer informationLayer informationHTML files (*.html)HTML files (*.html)Vector informationVector informationVector miscellaneousVector miscellaneousoptionsDialogWarning!Warning!You need to add some APIs file in order to compileYou need to add some APIs file in order to compilePlease specify API file or check "Use preloaded API files"Please specify API file or check "Use preloaded API files"The APIs file was not compiled, click on "Compile APIs…"The APIs file was not compiled, click on "Compile APIs…"parentInvalid CSW connections XML.Invalid CSW connections XML.Cannot parse XML file: {0}Cannot parse XML file: {0}Cannot open file: {0}Cannot open file: {0}Loading ConnectionsLoading ConnectionsChoose GeoPackage fileChoose GeoPackage filepct2rgbInput layerInput layerBand numberBand numberGenerate a RGBA fileGenerate a RGBA fileRaster conversionRaster conversionPCT to RGBPCT to RGBpolygonizeBand numberBand numberName of the field to createName of the field to createUse 8-connectednessUse 8-connectednessPolygonize (raster to vector)Polygonize (raster to vector)Raster conversionRaster conversionInput layerInput layerVectorizedVectorizedproximityGeoreferenced coordinatesGeoreferenced coordinatesPixel coordinatesPixel coordinatesInput layerInput layerBand numberBand numberA list of pixel values in the source image to be considered target pixelsA list of pixel values in the source image to be considered target pixelsThe maximum distance to be generatedThe maximum distance to be generatedValue to be applied to all pixels that are within the -maxdist of target pixelsValue to be applied to all pixels that are within the -maxdist of target pixelsNodata value to use for the destination proximity rasterNodata value to use for the destination proximity rasterAdditional creation optionsAdditional creation optionsOutput data typeOutput data typeProximity mapProximity mapRaster analysisRaster analysisDistance unitsDistance unitsProximity (raster distance)Proximity (raster distance)rasterizeInput layerInput layerAdditional creation optionsAdditional creation optionsVector conversionVector conversionPixelsPixelsGeoreferenced unitsGeoreferenced unitsField to use for a burn-in valueField to use for a burn-in valueA fixed value to burnA fixed value to burnOutput raster size unitsOutput raster size unitsWidth/Horizontal resolutionWidth/Horizontal resolutionHeight/Vertical resolutionHeight/Vertical resolutionOutput extentOutput extentAssign a specified nodata value to output bandsAssign a specified nodata value to output bandsOutput data typeOutput data typePre-initialize the output image with valuePre-initialize the output image with valueInvert rasterizationInvert rasterizationRasterizedRasterizedRasterize (vector to raster)Rasterize (vector to raster)rasterize_overInput layerInput layerAttribute fieldAttribute fieldExisting raster layerExisting raster layerRasterize (write over existing raster)Rasterize (write over existing raster)Vector conversionVector conversionrearrange_bandsInput layerInput layerSelected band(s)Selected band(s)Additional creation optionsAdditional creation optionsOutput data typeOutput data typeConvertedConvertedRearrange bandsRearrange bandsRaster conversionRaster conversionThis algorithm creates a new raster using selected band(s) from a given raster layer.
The algorithm also makes it possible to reorder the bands for the newly-created raster.This algorithm creates a new raster using selected band(s) from a given raster layer.
The algorithm also makes it possible to reorder the bands for the newly-created raster.retileRetileRetileNearest neighbourNearest neighbourBilinearBilinearCubicCubicCubic splineCubic splineLanczos windowed sincLanczos windowed sincInput filesInput filesTile widthTile widthTile heightTile heightOverlap in pixels between consecutive tilesOverlap in pixels between consecutive tilesNumber of pyramids levels to buildNumber of pyramids levels to buildSource coordinate reference systemSource coordinate reference systemResampling methodResampling methodAdditional creation optionsAdditional creation optionsOutput data typeOutput data typeBuild only the pyramidsBuild only the pyramidsUse separate directory for each tiles rowUse separate directory for each tiles rowOutput directoryOutput directoryCSV file containing the tile(s) georeferencing informationCSV file containing the tile(s) georeferencing informationRaster miscellaneousRaster miscellaneousColumn delimiter used in the CSV fileColumn delimiter used in the CSV filergb2pctInput layerInput layerNumber of colorsNumber of colorsRGB to PCTRGB to PCTRaster conversionRaster conversionroughnessInput layerInput layerBand numberBand numberCompute edgesCompute edgesAdditional creation optionsAdditional creation optionsRoughnessRoughnessRaster analysisRaster analysisrulesDialogTopology Rule SettingsTopology Rule SettingsCurrent RulesCurrent RulesAdd RuleAdd RuleRuleRuleLayer #1Layer #1Layer #2Layer #2Layer1IDLayer1IDLayer2IDLayer2IDNo layerNo layerDelete RuleDelete RuleTestTestsieveSieveSieveInput layerInput layerThresholdThresholdUse 8-connectednessUse 8-connectednessDo not use the default validity mask for the input bandDo not use the default validity mask for the input bandValidity maskValidity maskRaster analysisRaster analysisSievedSievedslopeInput layerInput layerBand numberBand numberRatio of vertical units to horizontalRatio of vertical units to horizontalSlope expressed as percent instead of degreesSlope expressed as percent instead of degreesCompute edgesCompute edgesUse Zevenbergen&Thorne formula instead of the Horn's oneUse Zevenbergen&Thorne formula instead of the Horn's oneAdditional creation optionsAdditional creation optionsRaster analysisRaster analysisSlopeSlopesymbol_angleAngle of symbol used to render the feature (valid for marker symbols only).Angle of symbol used to render the feature (valid for marker symbols only).symbol_colorColor of symbol used to render the feature.Color of symbol used to render the feature.topolTestTopology pluginTopology pluginFirst geometry invalid in dangling line test.First geometry invalid in dangling line test.Failed to import first geometry into GEOS in dangling line test.Failed to import first geometry into GEOS in dangling line test.Invalid second geometry in duplicate geometry test.Invalid second geometry in duplicate geometry test.Failed to import second geometry into GEOS in duplicate geometry test.Failed to import second geometry into GEOS in duplicate geometry test.Invalid second geometry in overlaps test.Invalid second geometry in overlaps test.Failed to import second geometry into GEOS in overlaps test.Failed to import second geometry into GEOS in overlaps test.Skipping invalid second geometry of feature %1 in overlaps test.Skipping invalid second geometry of feature %1 in overlaps test.Skipping invalid first geometry in pseudo line test.Skipping invalid first geometry in pseudo line test.Failed to import first geometry into GEOS in pseudo line test.Failed to import first geometry into GEOS in pseudo line test.Invalid geometry in validity test.Invalid geometry in validity test.Invalid geometry in covering test.Invalid geometry in covering test.Second geometry missing.Second geometry missing.Second geometry missing or GEOS import failed.Second geometry missing or GEOS import failed.Missing geometry in multipart check.Missing geometry in multipart check.First layer not found in registry.First layer not found in registry.Second layer not found in registry.Second layer not found in registry.must not have invalid geometriesmust not have invalid geometriesmust not have danglesmust not have danglesmust not have duplicatesmust not have duplicatesmust not have pseudosmust not have pseudosmust not overlapmust not overlapmust not have gapsmust not have gapsmust not have multi-part geometriesmust not have multi-part geometriesmust not overlap withmust not overlap withmust be covered bymust be covered bymust be covered by endpoints ofmust be covered by endpoints ofend points must be covered byend points must be covered bymust be insidemust be insidemust containmust containtpiInput layerInput layerBand numberBand numberCompute edgesCompute edgesAdditional creation optionsAdditional creation optionsTerrain Ruggedness IndexTerrain Ruggedness IndexTopographic Position Index (TPI)Topographic Position Index (TPI)Raster analysisRaster analysistranslateInput layerInput layerOverride the projection for the output fileOverride the projection for the output fileAssign a specified nodata value to output bandsAssign a specified nodata value to output bandsCopy all subdatasets of this file to individual output filesCopy all subdatasets of this file to individual output filesAdditional creation optionsAdditional creation optionsOutput data typeOutput data typeConvertedConvertedRaster conversionRaster conversionTranslate (convert format)Translate (convert format)triInput layerInput layerBand numberBand numberCompute edgesCompute edgesAdditional creation optionsAdditional creation optionsTerrain Ruggedness IndexTerrain Ruggedness IndexTerrain Ruggedness Index (TRI)Terrain Ruggedness Index (TRI)Raster analysisRaster analysisvariable_helpCurrent QGIS version string.Current QGIS version string.Current QGIS version number.Current QGIS version number.Current QGIS release name.Current QGIS release name.Operating system name, e.g., 'windows', 'linux' or 'osx'.Operating system name, e.g., 'windows', 'linux' or 'osx'.QGIS platform, e.g., 'desktop' or 'server'.QGIS platform, e.g., 'desktop' or 'server'.Current user's operating system account name.Current user's operating system account name.Current user's operating system user name (if available).Current user's operating system user name (if available).Title of current project.Title of current project.Full path (including file name) of current project.Full path (including file name) of current project.Folder for current project.Folder for current project.Filename of current project.Filename of current project.Base name of current project's filename (without path and extension).Base name of current project's filename (without path and extension).Home path of current project.Home path of current project.Coordinate reference system of project (e.g., 'EPSG:4326').Coordinate reference system of project (e.g., 'EPSG:4326').Coordinate reference system of project (full definition).Coordinate reference system of project (full definition).Project author, taken from project metadata.Project author, taken from project metadata.Project abstract, taken from project metadata.Project abstract, taken from project metadata.Project creation date, taken from project metadata.Project creation date, taken from project metadata.Project identifier, taken from project metadata.Project identifier, taken from project metadata.Project keywords, taken from project metadata.Project keywords, taken from project metadata.Name of current layer.Name of current layer.ID of current layer.ID of current layer.The current layer.The current layer.Name of composition.Name of composition.Number of pages in composition.Number of pages in composition.Current page number in composition.Current page number in composition.Composition page height in mm.Composition page height in mm.Composition page width in mm.Composition page width in mm.Composition resolution (DPI).Composition resolution (DPI).Current atlas coverage layer ID.Current atlas coverage layer ID.Current atlas coverage layer name.Current atlas coverage layer name.Total number of features in atlas.Total number of features in atlas.Current atlas feature number.Current atlas feature number.Current atlas file name.Current atlas file name.Current atlas page name.Current atlas page name.Current atlas feature (as feature object).Current atlas feature (as feature object).Current atlas feature ID.Current atlas feature ID.Current atlas feature geometry.Current atlas feature geometry.Layout item user ID (not necessarily unique).Layout item user ID (not necessarily unique).layout item unique ID.layout item unique ID.Left position of layout item (in mm).Left position of layout item (in mm).Top position of layout item (in mm).Top position of layout item (in mm).Width of layout item (in mm).Width of layout item (in mm).Height of layout item (in mm).Height of layout item (in mm).ID of current map destination. This will be 'canvas' for canvas renders, and the item ID for layout map renders.ID of current map destination. This will be 'canvas' for canvas renders, and the item ID for layout map renders.Current rotation of map.Current rotation of map.Current scale of map.Current scale of map.Geometry representing the current extent of the map.Geometry representing the current extent of the map.Center of map.Center of map.Width of map.Width of map.Height of map.Height of map.Coordinate reference system of map (e.g., 'EPSG:4326').Coordinate reference system of map (e.g., 'EPSG:4326').Coordinate reference system of map (full definition).Coordinate reference system of map (full definition).Units for map measurements.Units for map measurements.List of map layer IDs visible in the map.List of map layer IDs visible in the map.List of map layers visible in the map.List of map layers visible in the map.Stores the number of the current row.Stores the number of the current row.Current grid annotation value.Current grid annotation value.Current grid annotation axis (e.g., 'x' for longitude, 'y' for latitude).Current grid annotation axis (e.g., 'x' for longitude, 'y' for latitude).Last cursor position on the canvas in the project's geographical coordinates.Last cursor position on the canvas in the project's geographical coordinates.<p>An array with an item for each snapped point.</p><p>Each item is a map with the following keys:</p><dl><dt>valid</dt><dd>Boolean that indicates if the snapping result is valid</dd><dt>layer</dt><dd>The layer on which the snapped feature is</dd><dt>feature_id</dt><dd>The feature id of the snapped feature</dd><dt>vertex_index</dt><dd>The index of the snapped vertex</dd><dt>distance</dt><dd>The distance between the mouse cursor and the snapped point at the time of snapping</dd></dl><p>An array with an item for each snapped point.</p><p>Each item is a map with the following keys:</p><dl><dt>valid</dt><dd>Boolean that indicates if the snapping result is valid</dd><dt>layer</dt><dd>The layer on which the snapped feature is</dd><dt>feature_id</dt><dd>The feature id of the snapped feature</dd><dt>vertex_index</dt><dd>The index of the snapped vertex</dd><dt>distance</dt><dd>The distance between the mouse cursor and the snapped point at the time of snapping</dd></dl>Number of parts in rendered feature's geometry.Number of parts in rendered feature's geometry.Current geometry part number for feature being rendered.Current geometry part number for feature being rendered.Number of points in the rendered geometry's part. It is only meaningful for line geometries and for symbol layers that set this variable.Number of points in the rendered geometry's part. It is only meaningful for line geometries and for symbol layers that set this variable.Current point number in the rendered geometry's part. It is only meaningful for line geometries and for symbol layers that set this variable.Current point number in the rendered geometry's part. It is only meaningful for line geometries and for symbol layers that set this variable.not setnot set<p>Current value: %1</p><p>Current value: %1</p>warpNearest neighbourNearest neighbourBilinearBilinearCubicCubicCubic splineCubic splineLanczos windowed sincLanczos windowed sincAverageAverageModeModeMaximumMaximumMinimumMinimumMedianMedianFirst quartileFirst quartileThird quartileThird quartileInput layerInput layerSource CRSSource CRSTarget CRSTarget CRSNodata value for output bandsNodata value for output bandsOutput file resolution in target georeferenced unitsOutput file resolution in target georeferenced unitsResampling method to useResampling method to useAdditional creation optionsAdditional creation optionsOutput data typeOutput data typeGeoreferenced extents of output file to be createdGeoreferenced extents of output file to be createdCRS of the target raster extentCRS of the target raster extentUse multithreaded warping implementationUse multithreaded warping implementationRaster projectionsRaster projectionstransform,reproject,crs,srstransform,reproject,crs,srsWarp (reproject)Warp (reproject)ReprojectedReprojected